[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21235.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->32 PF09710 * Trep_dent_lipo 0.00011 44.8 29/394  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21235.1 GT:GENE AAZ21235.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(403276..403392) GB:FROM 403276 GB:TO 403392 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21235.1 GB:DB_XREF GI:71062232 LENGTH 38 SQ:AASEQ MIKKLILIFIICSFLFSCGKKGDPQYEGNEMVFPKSVD GT:EXON 1|1-38:0| TM:NTM 1 TM:REGION 5->19| SEG 2->18|ikklilifiicsflfsc| HM:PFM:NREP 1 HM:PFM:REP 4->32|PF09710|0.00011|44.8|29/394|Trep_dent_lipo| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 37-38| PSIPRED cHHHHHHHHHHHHHHHHccccccccccccEEccccccc //