[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21249.1
DDBJ      :             Thioesterase superfamily protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->81 2p3rG PDBj 8e-04 31.7 %
:BLT:PDB   69->152 2h4uD PDBj 1e-07 28.6 %
:RPS:PDB   43->163 3dkzA PDBj 1e-15 17.4 %
:RPS:SCOP  33->172 2hboA1  d.38.1.5 * 2e-25 21.2 %
:HMM:SCOP  38->163 2cy9A1 d.38.1.5 * 1.4e-25 31.2 %
:RPS:PFM   77->133 PF03061 * 4HBT 2e-05 33.3 %
:HMM:PFM   78->146 PF03061 * 4HBT 1.4e-12 30.4 69/79  
:BLT:SWISS 22->81 GLPK_SHIDS 6e-04 33.3 %
:BLT:SWISS 69->161 Y474_PSEAE 8e-13 37.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21249.1 GT:GENE AAZ21249.1 GT:PRODUCT Thioesterase superfamily protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(414886..415407) GB:FROM 414886 GB:TO 415407 GB:DIRECTION - GB:PRODUCT Thioesterase superfamily protein GB:PROTEIN_ID AAZ21249.1 GB:DB_XREF GI:71062246 LENGTH 173 SQ:AASEQ MATKIISTKISYIFFYNCFYNLINFNLHIIKIMSNEFEQISIKSGFMKHNGGVLFRTMSETEYEFKSIINENHLNNAGITHGGYLSALIDAGAGTAAHRASGNAPCVTISLDLKFIGASKVGDEITGFTRILKKTNSLVFLFCELKCNNKIITSASGIWKILKIKSSNLGPGG GT:EXON 1|1-173:0| BL:SWS:NREP 2 BL:SWS:REP 22->81|GLPK_SHIDS|6e-04|33.3|60/100| BL:SWS:REP 69->161|Y474_PSEAE|8e-13|37.6|93/134| BL:PDB:NREP 2 BL:PDB:REP 22->81|2p3rG|8e-04|31.7|60/510| BL:PDB:REP 69->152|2h4uD|1e-07|28.6|84/130| RP:PDB:NREP 1 RP:PDB:REP 43->163|3dkzA|1e-15|17.4|115/121| RP:PFM:NREP 1 RP:PFM:REP 77->133|PF03061|2e-05|33.3|57/79|4HBT| HM:PFM:NREP 1 HM:PFM:REP 78->146|PF03061|1.4e-12|30.4|69/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 33->172|2hboA1|2e-25|21.2|137/142|d.38.1.5| HM:SCP:REP 38->163|2cy9A1|1.4e-25|31.2|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 32 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------211---2-211------------11211211--2--------------------1----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 94.8 SQ:SECSTR #######TcccEEEEEEEEEEEEEcccccccHHccccHHHHHcccHHHHHTEcEEEEEETTEEEEEEccccTTccccccccHHHHHHHHHHHHHTTTTcHHccTTccEEEEEEEEEccccccEEEEEEEEEEEEcccEEEEEEEEEETccEEEEEEEEEEEccTTTTEEEE## DISOP:02AL 1-3, 165-173| PSIPRED cccEEEEHHHHEEEHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHcccEEEEEEcccEEEEEEEEcHHHHccccEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEcccccccEEEEEEEEEEcccEEEEEEEEEEEccEEEEEEEEEEEEEEcccccccccc //