[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21273.1
DDBJ      :             BolA-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.6
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  13->95 1v9jA_ d.52.6.1 * 7.2e-07 20.3 %
:HMM:PFM   22->92 PF01722 * BolA 8.4e-13 35.8 67/75  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21273.1 GT:GENE AAZ21273.1 GT:PRODUCT BolA-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 447870..448157 GB:FROM 447870 GB:TO 448157 GB:DIRECTION + GB:PRODUCT BolA-like protein GB:PROTEIN_ID AAZ21273.1 GB:DB_XREF GI:71062270 LENGTH 95 SQ:AASEQ MLYSNKLLFMNINELIKIVKNKLEAKIVIQDLKIEDKSFLHKNHKGNQEGMFHLKLIIKSEELKKLNKIVSTKKIYNILDHELKEHIHSIQILLS GT:EXON 1|1-95:0| SEG 54->69|lkliikseelkklnki| HM:PFM:NREP 1 HM:PFM:REP 22->92|PF01722|8.4e-13|35.8|67/75|BolA| HM:SCP:REP 13->95|1v9jA_|7.2e-07|20.3|74/113|d.52.6.1|1/1|BolA-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccEEEEEEHHHHHHHHHHHHHHHEEEEEccccHHHHHHcccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //