[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21290.1
DDBJ      :             Bacterial ribonuclease P protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->115 1nz0A_ d.14.1.2 * 3.5e-16 26.9 %
:HMM:PFM   6->112 PF00825 * Ribonuclease_P 2.8e-17 23.1 104/111  
:PROS 54->68|PS00648|RIBONUCLEASE_P
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21290.1 GT:GENE AAZ21290.1 GT:PRODUCT Bacterial ribonuclease P protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(461031..461375) GB:FROM 461031 GB:TO 461375 GB:DIRECTION - GB:PRODUCT Bacterial ribonuclease P protein GB:PROTEIN_ID AAZ21290.1 GB:DB_XREF GI:71062287 LENGTH 114 SQ:AASEQ MKSKIVALSKNEDFKNLLKKKKISNKYITLFFGPLADKDNKKLNISFVAKKKLIRSAVKRNKIKRRLRNIMNEAIKKVSINFNYSYLVIAKITMLNNEYAIIKDTLFQDIEKIK GT:EXON 1|1-114:0| PROS 54->68|PS00648|RIBONUCLEASE_P|PDOC00558| SEG 15->26|knllkkkkisnk| SEG 59->70|krnkikrrlrni| HM:PFM:NREP 1 HM:PFM:REP 6->112|PF00825|2.8e-17|23.1|104/111|Ribonuclease_P| HM:SCP:REP 6->115|1nz0A_|3.5e-16|26.9|104/109|d.14.1.2|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 5-8| PSIPRED ccccEEEccccHHHHHHHHHHcccccEEEEEEEcccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEHcccHHHHHHHHHHHHHHHcc //