[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21291.1
DDBJ      :             DedA family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->191 PF09335 * SNARE_assoc 8.7e-25 31.0 113/123  
:HMM:PFM   203->229 PF03878 * YIF1 0.00042 38.5 26/240  
:BLT:SWISS 60->196 TM41_CAEEL 1e-10 24.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21291.1 GT:GENE AAZ21291.1 GT:PRODUCT DedA family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 461643..462362 GB:FROM 461643 GB:TO 462362 GB:DIRECTION + GB:PRODUCT DedA family protein GB:PROTEIN_ID AAZ21291.1 GB:DB_XREF GI:71062288 LENGTH 239 SQ:AASEQ MEKSKKVKITLGLFYLLVVSSFLYFFLSKFTLEELTSYEFIKNNRDYFFGLKQTNLFLISLIFLTATIIWVVMAGFGLPVALLAGFIFGKWLGTIILIIGMTIGATILYIIGNYFFKEIIKEKFLNRFKNLEVKFKKSEFIYLLAYRFIGGIPFALSNVLPCIFNVRVSNFFWATLIGLTPPLFLVVSIGSGLEKIIEQNLEAPRIIDLIYSPDIYIPMIAFGALLVAAIVARKIFYKK GT:EXON 1|1-239:0| BL:SWS:NREP 1 BL:SWS:REP 60->196|TM41_CAEEL|1e-10|24.8|137/246| TM:NTM 6 TM:REGION 8->30| TM:REGION 60->82| TM:REGION 93->115| TM:REGION 141->163| TM:REGION 172->194| TM:REGION 211->232| SEG 13->28|lfyllvvssflyffls| SEG 92->108|lgtiiliigmtigatil| HM:PFM:NREP 2 HM:PFM:REP 79->191|PF09335|8.7e-25|31.0|113/123|SNARE_assoc| HM:PFM:REP 203->229|PF03878|0.00042|38.5|26/240|YIF1| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------1-----------1------1----------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------------------------1---------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //