[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21292.1
DDBJ      :             unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->42 PF01632 * Ribosomal_L35p 0.00014 30.6 36/61  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21292.1 GT:GENE AAZ21292.1 GT:PRODUCT unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 462540..462737 GB:FROM 462540 GB:TO 462737 GB:DIRECTION + GB:PRODUCT unknown protein GB:PROTEIN_ID AAZ21292.1 GB:DB_XREF GI:71062289 LENGTH 65 SQ:AASEQ MGIHYDYKSTKGNKLMEKQAKREKKLAEKKAKREAKEGPKVQEEPEKTLDASKPITLDFLTNPDK GT:EXON 1|1-65:0| SEG 17->37|ekqakrekklaekkakreake| HM:PFM:NREP 1 HM:PFM:REP 7->42|PF01632|0.00014|30.6|36/61|Ribosomal_L35p| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 12-48, 64-65| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccEEEEEcccccc //