[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21304.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  5/915 : Eukaryota  1/199 : Viruses  3/175   --->[See Alignment]
c.52.1
:214 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  112->160 1w36B3  c.52.1.24 * 2e-05 26.5 %
:HMM:PFM   27->92 PF09385 * HisK_N 1.6e-06 30.2 63/133  
:BLT:SWISS 15->211 CT072_HUMAN 2e-06 23.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21304.1 GT:GENE AAZ21304.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 471726..472370 GB:FROM 471726 GB:TO 472370 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE possible atypical protein kinase GB:PROTEIN_ID AAZ21304.1 GB:DB_XREF GI:71062301 LENGTH 214 SQ:AASEQ MVSGSRMYAVNQEKLPSVTSILQATQSEEKKASLANWKARVGAAEANRIKNDASSRGTSMHSHLEKYLLGQLNLELLEEEASKSKKMADEIIEQGIKGKLSEIYGTEATLYYPGKYAGTCDACGVYEGQETIIDFKQSNKPKKEEWIEDYYLQLGAYSLAHNVVHNSNITQGIVLLCTVDNLFQDFRIQGVKLEEYQNKFLEKVEQYYHQRNMN GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 15->211|CT072_HUMAN|2e-06|23.7|194/344| SEG 64->80|lekyllgqlnlelleee| HM:PFM:NREP 1 HM:PFM:REP 27->92|PF09385|1.6e-06|30.2|63/133|HisK_N| RP:SCP:NREP 1 RP:SCP:REP 112->160|1w36B3|2e-05|26.5|49/276|c.52.1.24| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN ------------------------------------------------------------------11 ----------------------------------------------------------------------------------------------------------------------------------------------------11------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- -----1-----------------11------------------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-3, 212-214| PSIPRED ccccEEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccEEEEEEEEccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHcccccEEEEEEEEEEccccccccEEcHHHHHHHHHHHHHHHHHHHHHcccc //