[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21318.1
DDBJ      :             unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->180 PF06835 * DUF1239 2.3e-13 17.4 161/176  
:BLT:SWISS 63->146 PMM_TOBAC 3e-05 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21318.1 GT:GENE AAZ21318.1 GT:PRODUCT unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(484450..485034) GB:FROM 484450 GB:TO 485034 GB:DIRECTION - GB:PRODUCT unknown protein GB:PROTEIN_ID AAZ21318.1 GB:DB_XREF GI:71062315 LENGTH 194 SQ:AASEQ MNKKTGLQVVMVLIIILISLWFYLKYFTENFEDVKETQVKEKIDENQNSNSTYIDDINYVSTDVKGNKYQITAKQAEIKVENSDVMFLRDVVAFIFIKDSDTVKITSNFGKYNSKNYDTIFSENVIVIYPRHKISGEYLDFSFLSNLGTFTENVVYAGEKTNLYADKIEMNLTTKDTKIFMNDTGKKVLIEGTK GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 63->146|PMM_TOBAC|3e-05|38.3|81/252| TM:NTM 1 TM:REGION 5->27| SEG 7->20|lqvvmvliiilisl| HM:PFM:NREP 1 HM:PFM:REP 13->180|PF06835|2.3e-13|17.4|161/176|DUF1239| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 39-50| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccEEEEcccEEEEcccccEEEEEEEEEEEEEcccccHHHHHHEEEEEEccccEEEEEEcccccccccccEEEcccEEEEEEcccccccEEcHHHHHHcccHHHcEEEEcccccEEEEEEEEEEEcccEEEEEEccccEEEEEccc //