[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21336.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->136 PF06676 * DUF1178 1e-14 33.6 %
:HMM:PFM   1->142 PF06676 * DUF1178 3.6e-44 36.4 140/148  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21336.1 GT:GENE AAZ21336.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 503781..504212 GB:FROM 503781 GB:TO 504212 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE similar to protein of unknown function (DUF1178) GB:PROTEIN_ID AAZ21336.1 GB:DB_XREF GI:71062333 LENGTH 143 SQ:AASEQ MIKYKLICKDCETTFDSWFSSSKEYEKLKKKKFLNCHFCNSLNVGKGLMSPNVSTSKNILTDIDSSSEKYKEIKKTIYKYQEFIKKNFEYVGENFAYEARSLHYKDKKKAKGIYGTATKKDLNELKEEGIKAEILPWIKDTTN GT:EXON 1|1-143:0| SEG 19->34|fssskeyeklkkkkfl| SEG 63->82|idsssekykeikktiykyqe| RP:PFM:NREP 1 RP:PFM:REP 1->136|PF06676|1e-14|33.6|134/146|DUF1178| HM:PFM:NREP 1 HM:PFM:REP 1->142|PF06676|3.6e-44|36.4|140/148|DUF1178| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------1-----11111111111---------1-1-111-1-1--1----111-------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 47-71, 141-143| PSIPRED ccccEEEEcccccccHHccccHHHHHHHHHcccccccccccccEEEHEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccEEEccccccccc //