[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21348.1
DDBJ      :             acetolactate synthase  II large chain
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  745/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
c.31.1c.36.1
:578 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   9->279,407->539 1jscA PDBj 1e-29 29.0 %
:RPS:PDB   5->537 1bfdA PDBj 7e-59 14.4 %
:RPS:SCOP  5->169 1bfdA2  c.36.1.5 * 2e-38 17.6 %
:RPS:SCOP  198->287 1jscA1  c.31.1.3 * 6e-15 26.7 %
:RPS:SCOP  383->542 1powA3  c.36.1.9 * 1e-16 17.9 %
:HMM:SCOP  1->189 2c31A2 c.36.1.5 * 2.9e-38 29.2 %
:HMM:SCOP  186->371 1ybhA1 c.31.1.3 * 1.7e-24 24.6 %
:HMM:SCOP  354->549 1upaA3 c.36.1.9 * 8.4e-32 24.4 %
:RPS:PFM   7->168 PF02776 * TPP_enzyme_N 2e-25 37.0 %
:RPS:PFM   199->288 PF00205 * TPP_enzyme_M 3e-07 29.2 %
:RPS:PFM   407->534 PF02775 * TPP_enzyme_C 4e-11 27.2 %
:HMM:PFM   1->173 PF02776 * TPP_enzyme_N 2.1e-48 34.7 167/172  
:HMM:PFM   402->534 PF02775 * TPP_enzyme_C 6e-26 26.5 132/150  
:HMM:PFM   195->331 PF00205 * TPP_enzyme_M 2.7e-19 28.1 135/137  
:BLT:SWISS 4->513 ILVI_BUCSC 1e-40 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21348.1 GT:GENE AAZ21348.1 GT:PRODUCT acetolactate synthase II large chain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(519133..520869) GB:FROM 519133 GB:TO 520869 GB:DIRECTION - GB:PRODUCT acetolactate synthase II large chain GB:PROTEIN_ID AAZ21348.1 GB:DB_XREF GI:71062345 LENGTH 578 SQ:AASEQ MKTTDLLAQVLKKNNLKCAFGLQGGAVVHIFDSLIKKNISVTFTHHEQSAALAAVSYAKSVNGIGCVVVTTGPGSTNSITGLLAAWQDSIPVIFISGQARAIHTSYKKKVRQVGTQEVNICDIVRPITKYTTFINQTKNFQIEIDKAIKIAISGRPGPVWIDIALDIQWQNIPLLKKIKKIIPKKIKINQTKKINKSIDLINKSTNPLFIIGYGAVLSGIDRKIINQTLIKKSIPSVLTWNTADLIPTNNKYNLGIVGMSGQRGANKAVFNSDLIVCLGNHLSIPHTTTLYKNYAPNAKKIIINIDKDQLKNLNVKFHLKINMDCKDYLQKIIKNLTKKKTYQLKQFKKLNWYEPLEKKIPNSNSFIRKLTTKIKNKKNIIIDGGGTALYAGFQSSVIDSKTKITCSSAISSMGTGLSETIGSHKSKKFYKHICIIGDGSFLMNCQDLQTIYQENINVLIIIVNNNGYLAIRHTQKEFLNERYFGTHPSDGISFPNFSRLAKAFKIKYKKINTIDKSKKFIQNCNKIKGPIIVDLIVDESQPSLFKQGYKKNADGSFAPSDLSEMYPFIKDPISNTNN GT:EXON 1|1-578:0| BL:SWS:NREP 1 BL:SWS:REP 4->513|ILVI_BUCSC|1e-40|28.2|497/574| SEG 170->196|qnipllkkikkiipkkikinqtkkink| SEG 292->312|knyapnakkiiinidkdqlkn| SEG 334->350|knltkkktyqlkqfkkl| SEG 373->382|kiknkkniii| SEG 455->466|ninvliiivnnn| BL:PDB:NREP 1 BL:PDB:REP 9->279,407->539|1jscA|1e-29|29.0|371/541| RP:PDB:NREP 1 RP:PDB:REP 5->537|1bfdA|7e-59|14.4|515/523| RP:PFM:NREP 3 RP:PFM:REP 7->168|PF02776|2e-25|37.0|154/170|TPP_enzyme_N| RP:PFM:REP 199->288|PF00205|3e-07|29.2|89/138|TPP_enzyme_M| RP:PFM:REP 407->534|PF02775|4e-11|27.2|125/139|TPP_enzyme_C| HM:PFM:NREP 3 HM:PFM:REP 1->173|PF02776|2.1e-48|34.7|167/172|TPP_enzyme_N| HM:PFM:REP 402->534|PF02775|6e-26|26.5|132/150|TPP_enzyme_C| HM:PFM:REP 195->331|PF00205|2.7e-19|28.1|135/137|TPP_enzyme_M| GO:PFM:NREP 5 GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02776|IPR012001| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00205|IPR012000| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF00205|IPR012000| GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 3 RP:SCP:REP 5->169|1bfdA2|2e-38|17.6|159/180|c.36.1.5| RP:SCP:REP 198->287|1jscA1|6e-15|26.7|90/181|c.31.1.3| RP:SCP:REP 383->542|1powA3|1e-16|17.9|156/228|c.36.1.9| HM:SCP:REP 1->189|2c31A2|2.9e-38|29.2|185/0|c.36.1.5|1/2|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 186->371|1ybhA1|1.7e-24|24.6|179/0|c.31.1.3|1/1|DHS-like NAD/FAD-binding domain| HM:SCP:REP 354->549|1upaA3|8.4e-32|24.4|193/0|c.36.1.9|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 2023 OP:NHOMOORG 951 OP:PATTERN 11-1--3332233333-31221141--211-1242112122211212213343111-----11-1-11 2231321211112123322-232243222223222231661223112-111133422211222-12334321212111-211211111111111--111--111121211---------------21111111111222211111522223332211112111222332321111111211111211111-122333332331343334222222333224232-32222214233323333333333133331-1-12-1--1122211111122111111----12211111111111-------------111222111122124-------4-321331---1-2--2122143222121221112--1-112112-11-1113321125123211111111113-32322414462-2222135443563312114321224353333333321111221-----------------------------33222258655444344333333349555535435353621433221224244643323111211111111111222-622112222233412113112331121122521111111111-1-------1111211322231312222222322222222322222-1-211111111133442434555465655-5535655545555554553445542234344434444444442454555541-43333332333311-----------22611222212-22212112112211112122666645332577621112----1---313233333322222221111111111111111331122--------------------------------------1--1-111221 ----11--------1421121223335111111111111111112211121122-121111121111111121111111111111111-11122111111111122--1-222211---------1-11272-222----1--21-1--22---1--131211221---2-111111118111134113113112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 575-578| PSIPRED ccHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccHHHHHHHHEEEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEccccHHccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccHHHHHHHHcccEEEEEcccccccccccccccccccccEEEEEccHHHHHcccccccEEEEccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHccHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHccccccccccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccHHHccccccccccccc //