[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21353.1
DDBJ      :             FAD oxidase family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
d.145.1
:454 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   122->173 2exrA PDBj 8e-06 30.8 %
:RPS:PDB   31->173 1ahuA PDBj 4e-17 11.2 %
:RPS:SCOP  31->173 1w1oA2  d.145.1.1 * 3e-16 17.5 %
:HMM:SCOP  15->194 1w1oA2 d.145.1.1 * 3.2e-31 22.2 %
:RPS:PFM   31->159 PF01565 * FAD_binding_4 2e-09 21.7 %
:HMM:PFM   31->163 PF01565 * FAD_binding_4 8.1e-26 27.3 132/138  
:HMM:PFM   191->452 PF04030 * ALO 4e-10 16.7 251/260  
:BLT:SWISS 33->174 GGLO_PIG 6e-12 25.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21353.1 GT:GENE AAZ21353.1 GT:PRODUCT FAD oxidase family GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(524613..525977) GB:FROM 524613 GB:TO 525977 GB:DIRECTION - GB:PRODUCT FAD oxidase family GB:PROTEIN_ID AAZ21353.1 GB:DB_XREF GI:71062350 LENGTH 454 SQ:AASEQ MLDFLNNVKPKTIKYYSRFNINDKKNKAHHIYPKNITELKKIFKYAKTKKQKILCVGNSKSWFDTVSNRHGIIINLKKFNRQIKLNRSKNLCVSSNVTLEEIYQFLNPLNLTLYNLPGYLNITVGGCISNNVHGKDSFKFGTFAENIIDFTILLPNGKIKKCSKMINKEIFYAAIGGLGLIGIILNVKLNVKKITSYVITENHKCKDYKQLIDVIYQDKDKYDYIYSWVDTVRGRGIVFKSKHINLNSTEFKKNKIKKNLNNLKHLIIKFFLSQIMKRDFMSFLNYIFFIINKRFSKKIENIKDIVELSKVNAIDLPNLIYPNSFVEIQFIIPKKKIRILKNFLKLLKKENLSALITGIKIHKKSIGYLTFADEGISISINIICNYNDKDKISKIKKINNYIIKNKLKIYLAKDFFLDKSDINLIYPNFKKFLNVKKKFDKQDLLYSDFLRRIS GT:EXON 1|1-454:0| BL:SWS:NREP 1 BL:SWS:REP 33->174|GGLO_PIG|6e-12|25.0|140/440| TM:NTM 2 TM:REGION 100->122| TM:REGION 169->191| SEG 106->121|lnplnltlynlpgyln| SEG 175->185|igglgligiil| SEG 212->226|idviyqdkdkydyiy| SEG 252->269|kknkikknlnnlkhliik| SEG 334->352|kkkirilknflkllkkenl| SEG 376->411|isisiniicnyndkdkiskikkinnyiiknklkiyl| SEG 429->441|fkkflnvkkkfdk| BL:PDB:NREP 1 BL:PDB:REP 122->173|2exrA|8e-06|30.8|52/483| RP:PDB:NREP 1 RP:PDB:REP 31->173|1ahuA|4e-17|11.2|143/555| RP:PFM:NREP 1 RP:PFM:REP 31->159|PF01565|2e-09|21.7|129/139|FAD_binding_4| HM:PFM:NREP 2 HM:PFM:REP 31->163|PF01565|8.1e-26|27.3|132/138|FAD_binding_4| HM:PFM:REP 191->452|PF04030|4e-10|16.7|251/260|ALO| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| RP:SCP:NREP 1 RP:SCP:REP 31->173|1w1oA2|3e-16|17.5|143/206|d.145.1.1| HM:SCP:REP 15->194|1w1oA2|3.2e-31|22.2|180/206|d.145.1.1|1/1|FAD-binding domain| OP:NHOMO 30 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------1-----1--------------------------------------------11-----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1---------------------------------------------------------------1-----------------------------------------------------------------------------1------------------------------------------------------2-----------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111------------------------------------------------- --------------------111---111----111-------1----------------------------------------------------------------------------------------------------1-----------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 43.4 SQ:SECSTR ##############ccGGGccTTcccccEEEccccHHHHHHHHHHHHHHTccEEEEcccccTTTccccTTcEEEEcTTTccEEEEETTTTEEEcTTccHHHHHHHHHTTTGGGTEEcccccccccHHHHHHHTcccccTTccTGGGEEEEEEEcTTccEEEcGGGGccccccTHTTcTTccEEEEEEEEEEEEcccEEEEEEEEEccHHHH################################################################################################################################################################################################################################################### DISOP:02AL 454-455| PSIPRED ccccccccccHHHHHHHHHHHcccccccEEEccccHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEccccccEEEEccccEEEEEccccHHHHHHHHHHcccEEcccccccccccccccccccccccccccccHHHEEEEEEEEcccccEEEccccccHHHHHHHHHcccccEEEEEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHcccEEEEHHHHccccEEEEEccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccHHHccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHccccEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHc //