[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21359.1
DDBJ      :             UDP-glucose 4 epimerase
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  460/915 : Eukaryota  88/199 : Viruses  2/175   --->[See Alignment]
c.2.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->283 3eheA PDBj 2e-20 29.2 %
:RPS:PDB   2->287 1e7rA PDBj 1e-28 13.7 %
:RPS:SCOP  1->280 1bxkA  c.2.1.2 * 1e-36 25.1 %
:HMM:SCOP  2->298 2bllA1 c.2.1.2 * 8.6e-57 29.7 %
:RPS:PFM   4->226 PF01370 * Epimerase 7e-21 32.6 %
:HMM:PFM   4->229 PF01370 * Epimerase 5.5e-36 29.0 221/238  
:BLT:SWISS 4->284 GALE_LACHE 7e-23 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21359.1 GT:GENE AAZ21359.1 GT:PRODUCT UDP-glucose 4 epimerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 531418..532356 GB:FROM 531418 GB:TO 532356 GB:DIRECTION + GB:PRODUCT UDP-glucose 4 epimerase GB:NOTE GalE-like protein GB:PROTEIN_ID AAZ21359.1 GB:DB_XREF GI:71062356 LENGTH 312 SQ:AASEQ MKNILVTGGCGYVGVQLVPRLLNNNYKVIVIDTCWFGNKLKKNKNLTIIKKDIRSIEEKYFNNIDTVIHLASISNDPSSELNPKLAWEVGPLATYKILQICVKKKIKNFFYASSGSVYGVSKKLKVTEKTNLLPISDYNKQKMVTEKILETYSSKIRTVAIRPATVCGFSNRLRLDVTVNILTYQAYKNKIITVFGGKQIRPNIHISDMVDIYLFLLKNKKVKGIFNAGFENLSVLNIAQKIQKLTSCKIKILKSNDPRSYRLDSSKLLKTGFKPKRNVDFAISELLNFFNKKKFKSNDNNVNLKVIKKLYE GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 4->284|GALE_LACHE|7e-23|31.0|281/330| SEG 38->51|nklkknknltiikk| SEG 288->303|nffnkkkfksndnnvn| BL:PDB:NREP 1 BL:PDB:REP 4->283|3eheA|2e-20|29.2|271/290| RP:PDB:NREP 1 RP:PDB:REP 2->287|1e7rA|1e-28|13.7|277/314| RP:PFM:NREP 1 RP:PFM:REP 4->226|PF01370|7e-21|32.6|218/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 4->229|PF01370|5.5e-36|29.0|221/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 1->280|1bxkA|1e-36|25.1|275/341|c.2.1.2| HM:SCP:REP 2->298|2bllA1|8.6e-57|29.7|296/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1158 OP:NHOMOORG 611 OP:PATTERN --2-1-1111111221231111215222422-233213121211111215454122322221122--3 111-1111---1-1---11-1---1111111-1-1-1-23112211-----2------111--1211121-1111111----11332112---2-----1-233-24313--------------11122121133147732-112-3425443--11----1-1412445111122411-2-1111--111-22334345432355545244432436132112-111111221111111111111112---141112211212241122232121211121-11112211111-11--1-------------2--111----32-52333433323241442111122--1--3111511211311112221-422--1-----213432122312211211122212-221214-21211233-335443441-------2211-1----------121-411-------------------------1-2-2122---------------------1----------------------------------11-----------1--2---3-222113---3232241312-----12123121322231-1--111-2--1------------1---1111-11--11-1--111---1111-------1--1-1------------------1-----------111111--------------------------1-----------------43444----1-2----------1--112--------1--1-----2----22-1-1---1111-111-----------1------1-11---------33221133--------2------------1-----1--------2123212211313 ----3-------242-----------1-----------------------11----------1------2--------------1----111-1111111--1-23-1--4111112-----111--1-241-11--11-1-1111-1--11-2-21222122221-112B1122612--632--77C9-81-224231 -----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 287 STR:RPRED 92.0 SQ:SECSTR cEEEEEETTTcHHHHHHHHHHTTcTTEEEEcccTTTGGGTGGGTTccTTcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTTcccccccccccGGGHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTccHHHHHHHHHTccEEEEEccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccTTcEEHHHHHHHHHHHHTcccEEEEETTccccccccHHHHHTTccccccHHHHHHHHH######################### DISOP:02AL 312-313| PSIPRED ccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEccHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHcccccEEcccccEEccEEHHHHHHHHHHHHHccccccEEEEccccEEHHHHHHHHHHHccccccEEcccccccccccHHHHHHccccccccHHHHHHHHHHHHHHcccccccccEEHHHHHHHHc //