[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21364.1
DDBJ      :             unknown membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->135 PF02361 * CbiQ 2.5e-05 21.3 89/224  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21364.1 GT:GENE AAZ21364.1 GT:PRODUCT unknown membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 537246..537701 GB:FROM 537246 GB:TO 537701 GB:DIRECTION + GB:PRODUCT unknown membrane protein GB:PROTEIN_ID AAZ21364.1 GB:DB_XREF GI:71062361 LENGTH 151 SQ:AASEQ MSVSFEYHLIIFLIFVSIDILIYRFFKKNIIFSLKFFIIIFIIFINIFEINLLLINILFFYFLFSIFYTLTFTGIKNTSPSLFMIHHLANNDMSKKIQINENFLNQQFTKKRLKENFQKNFLIKKKKNIIISKKGKLFMYIFSTLKKTYNL GT:EXON 1|1-151:0| TM:NTM 2 TM:REGION 2->24| TM:REGION 42->64| SEG 25->67|ffkkniifslkffiiifiifinifeinlllinilffyflfsif| SEG 123->136|ikkkkniiiskkgk| HM:PFM:NREP 1 HM:PFM:REP 7->135|PF02361|2.5e-05|21.3|89/224|CbiQ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEHHccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHcc //