[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21384.1
DDBJ      :             unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->34 2z95D PDBj 4e-05 50.0 %
:BLT:SWISS 1->43 GM4D_YERE8 4e-04 39.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21384.1 GT:GENE AAZ21384.1 GT:PRODUCT unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(555992..556138) GB:FROM 555992 GB:TO 556138 GB:DIRECTION - GB:PRODUCT unknown protein GB:PROTEIN_ID AAZ21384.1 GB:DB_XREF GI:71062381 LENGTH 48 SQ:AASEQ MRLFKNYKFDEDYNLAAQSLVGTSFVNPIFTSQITCKNYVKKLFKKSC GT:EXON 1|1-48:0| BL:SWS:NREP 1 BL:SWS:REP 1->43|GM4D_YERE8|4e-04|39.5|43/372| BL:PDB:NREP 1 BL:PDB:REP 1->34|2z95D|4e-05|50.0|34/332| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 70.8 SQ:SECSTR HHHHHHHcccEEEEccccccHHHHHHcHHHHHHH############## DISOP:02AL 3-4| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccc //