[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21386.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->106 PF06339 * Ectoine_synth 2.1e-05 21.6 51/127  
:HMM:PFM   12->70 PF08787 * Alginate_lyase2 0.00021 21.1 57/236  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21386.1 GT:GENE AAZ21386.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 556386..556751 GB:FROM 556386 GB:TO 556751 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ21386.1 GB:DB_XREF GI:71062383 LENGTH 121 SQ:AASEQ MIYLSHRGNLRGRNKKKENHPDYINMALNKKFSVEVDVLFKKSNFYLGHDRPQYKVSDKFLLKKNNWGHAKNISALSELKKIKSHYFWHQEDQYTVTSKGFIWAYPGEKLTNDTIYASLSK GT:EXON 1|1-121:0| HM:PFM:NREP 2 HM:PFM:REP 56->106|PF06339|2.1e-05|21.6|51/127|Ectoine_synth| HM:PFM:REP 12->70|PF08787|0.00021|21.1|57/236|Alginate_lyase2| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 4-20| PSIPRED cEEEccccccccccccccccccEEEEEEccEEEEEEEEEEEEccEEEccccccEEEccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEcccEEEEcccccccccEEEEEEcc //