[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21388.1
DDBJ      :             unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:333 amino acids
:PSIPRED
:HMM:PFM   75->227 PF00953 * Glycos_transf_4 2.3e-20 24.5 151/159  
:HMM:PFM   40->52 PF10555 * MraY_sig1 0.00036 46.2 13/13  
:HMM:PFM   264->304 PF06847 * Arc_PepC_II 0.00056 29.3 41/93  
:BLT:SWISS 24->278 WECA_YERPE 7e-15 26.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21388.1 GT:GENE AAZ21388.1 GT:PRODUCT unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(558028..559029) GB:FROM 558028 GB:TO 559029 GB:DIRECTION - GB:PRODUCT unknown protein GB:PROTEIN_ID AAZ21388.1 GB:DB_XREF GI:71062385 LENGTH 333 SQ:AASEQ MFFKFFIFNFCLFFIFYFIISFFAKELKLIDYPNSEKTHKNPTPAIGGVIFLLLYISIFFQYLIFDELNYFHSKLVVASLLIFFIGYYDDLKDNNPYLKTFFFISVIFIFLFFNQEILIKKILISFIDVTYVLNNFFSYIFTILCFWLLMNSFNLTDGFNGVALSLAIIFFTSLITLFDLSEVDHFFIINIIFFLVIILIFNLFGKLFLGNNGAYLISFILAVYLIKFYNLKIINEKFFTDKIFLILMIPGLDMLRLFLERLKMKKNPLKRDKNHLHHNLKKIVPEKYVFLLYGLLVLIPIILDQVFNNITIPLIIIFFIIYLFLINRLRKLS GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 24->278|WECA_YERPE|7e-15|26.1|245/365| TM:NTM 11 TM:REGION 5->27| TM:REGION 44->66| TM:REGION 69->90| TM:REGION 98->119| TM:REGION 133->155| TM:REGION 160->182| TM:REGION 186->208| TM:REGION 214->236| TM:REGION 240->261| TM:REGION 283->305| TM:REGION 307->328| SEG 2->23|ffkffifnfclffifyfiisff| SEG 101->113|fffisvififlff| SEG 186->204|ffiiniifflviilifnlf| SEG 307->327|fnnitipliiiffiiylflin| HM:PFM:NREP 3 HM:PFM:REP 75->227|PF00953|2.3e-20|24.5|151/159|Glycos_transf_4| HM:PFM:REP 40->52|PF10555|0.00036|46.2|13/13|MraY_sig1| HM:PFM:REP 264->304|PF06847|0.00056|29.3|41/93|Arc_PepC_II| OP:NHOMO 77 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------1-----11-----1---------------------------------------1-1---------------------1----1------------------------------------------1-1-1-----------11111111111111-11-1---1--1-11111-----1----------1-----------------11111-1111111---------------1111111-1-----1----1----------1----111----1---------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------1----------------------------------1----1--------------1-----1----1----------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1-121-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //