[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21389.1
DDBJ      :             D-amino acid oxidoreductase family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:404 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->135 PF11246 * Phage_gp53 8.6e-05 22.6 53/193  
:BLT:SWISS 100->172 TOP1_SCHPO 9e-04 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21389.1 GT:GENE AAZ21389.1 GT:PRODUCT D-amino acid oxidoreductase family GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 559270..560484 GB:FROM 559270 GB:TO 560484 GB:DIRECTION + GB:PRODUCT D-amino acid oxidoreductase family GB:PROTEIN_ID AAZ21389.1 GB:DB_XREF GI:71062386 LENGTH 404 SQ:AASEQ MSKSSSDQHGWFHIGSLYAFLDNNNYLKGLIKNTKDIITYYSHFENLNMYLDKNGFLKFKKKNNGWFQTKDVKYLIASRNNKDLDDKHIFKKIKNIFAWEKKIKKFISRHNTLRTHNLNKHESPTTISNSNYFNYNKKRILKPNFSNLFINKDEFFLMNGFDKPMRSKLIYADLLESFYLNRGKCLLSYTFSKIIEKKNYCELNFKNKKKKIFSKKVIFANGTGLKKLVKDISIYESPLMVTYPKIFNKNIVKLTPNNNNTINHFLHESQNDFYSVIGSGLSCKLGDNKDKARVLKKFKNTCRLFFKNFDKIDFKKIYFGKKVEFTKKTKRNYDFKIFELSKKSVAVLPGKFSMSFNLATNIYRRFNNQQDPPLLRLKKNLRLSKDISNTRHYKMVKKYKSKIS GT:EXON 1|1-404:0| BL:SWS:NREP 1 BL:SWS:REP 100->172|TOP1_SCHPO|9e-04|29.4|68/100| SEG 53->65|kngflkfkkknng| SEG 204->216|nfknkkkkifskk| SEG 305->322|ffknfdkidfkkiyfgkk| SEG 372->383|ppllrlkknlrl| HM:PFM:NREP 1 HM:PFM:REP 83->135|PF11246|8.6e-05|22.6|53/193|Phage_gp53| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-9, 402-404| PSIPRED ccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEccccEEEEccccccccccccEEEEEcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcHHHHHHccHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHccEEEEEEccHHEEEEEccccccccccEEEEEEEEEEEEccccHHHHccccEEEccEEEEEEcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHcHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHcccEEEEEEHHHcccEEEEEEcccccEEEEEcccEEEHHHHHHHHHHHHHHHcccHHHHHHHHccHHHccccHHHHHHHHHHHHHcc //