[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21412.1
DDBJ      :             Metallo-phosphoesterase:Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  280/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.159.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->241 1t70A PDBj 9e-47 42.9 %
:RPS:PDB   2->259 2cv9A PDBj 6e-22 32.2 %
:RPS:SCOP  1->252 1t71A  d.159.1.9 * 7e-32 38.6 %
:HMM:SCOP  1->263 1t70A_ d.159.1.9 * 1.9e-75 41.3 %
:HMM:PFM   1->183 PF00149 * Metallophos 4.7e-07 18.6 177/200  
:BLT:SWISS 1->259 YMDB_BACSU 2e-53 43.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21412.1 GT:GENE AAZ21412.1 GT:PRODUCT Metallo-phosphoesterase:Conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 578051..578857 GB:FROM 578051 GB:TO 578857 GB:DIRECTION + GB:PRODUCT Metallo-phosphoesterase:Conserved hypothetical protein GB:PROTEIN_ID AAZ21412.1 GB:DB_XREF GI:71062409 LENGTH 268 SQ:AASEQ MKILFLGDVVGISGRSMVLNNLLSKIKDEKIDFVVVNGENAADSGAGLTEEICKDFFNCGVDVITTGNHVWDQKETMAHIEKENRLLRPKNLFEPSPGKGFGIFTAKNEMRVGVLNLMGNVFMKKCEDVFEAAEKFMKKYKLKEDYDFLLVDFHGEITSEKSAMGHFFDGKATLVVGTHTHIPTNDTRILKGGTAYQTDAGMCGDYDSVIGMNKDNSINRFLKKKSTKHFPAIGEASLCGVIVECDVETGLAKTVKNFIHGGELKNSQ GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 1->259|YMDB_BACSU|2e-53|43.3|254/264| BL:PDB:NREP 1 BL:PDB:REP 1->241|1t70A|9e-47|42.9|233/255| RP:PDB:NREP 1 RP:PDB:REP 2->259|2cv9A|6e-22|32.2|242/246| HM:PFM:NREP 1 HM:PFM:REP 1->183|PF00149|4.7e-07|18.6|177/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 1->252|1t71A|7e-32|38.6|249/281|d.159.1.9| HM:SCP:REP 1->263|1t70A_|1.9e-75|41.3|252/0|d.159.1.9|1/1|Metallo-dependent phosphatases| OP:NHOMO 290 OP:NHOMOORG 280 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------------1--------------------111111-------------------------------------11111111111-----111---------------------------------------1111111--11111111111111111111111111111111111111111111111111111111111111-1--------11----1----------------------------------------------------1--------------1---------1--1--11111111-1111111111-11111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----------------------------1----------------------------------------------------------------------------------11-11111-11111111111111-1-1---1---------------1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------222222222-111211-1111111111111111111----------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 96.6 SQ:SECSTR cEEEEEcccHcHHHHHHHHHHHHHHHGGGccEEEEEEcTTTTTcTccccHHHHHHHHHHTccEEEccTTTTccTTHHHHHHHHccEEccTTccTTcccccEEEEEETTTccEEEEEEEEccTTcccccHHHHHHHHcTTHHHHHccccEEEEEEEcccHHHHHHHHHHcTTccEEEEEcccccccccEEcTTccEEEccccccccccccTTccHHHHHHHHHHcccccccccccccEEEEEEEEcEEETTEEEEEEEEE######### DISOP:02AL 264-268| PSIPRED cEEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHccccEEEccccHHHHHHHHHHHcccccEEccccccccccccEEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHEEEccEEEEEEEcccccccccHHcccccEEEEEEcccccccccEEcccHHHHHHHHHHccccccEEEcccEEEEEEEEEEEcccccEEEEEEEEEcccccccc //