[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21413.1
DDBJ      :             protein with conserved domain of unknown function DUF28
Swiss-Prot:Y592_PELUB   RecName: Full=UPF0082 protein SAR11_0592;

Homologs  Archaea  0/68 : Bacteria  876/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
e.39.1
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->212 1lfpA PDBj 1e-43 44.7 %
:RPS:SCOP  3->238 1konA  e.39.1.1 * 2e-65 36.2 %
:HMM:SCOP  5->240 1lfpA_ e.39.1.1 * 1.3e-88 47.0 %
:RPS:PFM   5->235 PF01709 * DUF28 7e-46 45.5 %
:HMM:PFM   5->236 PF01709 * DUF28 1.3e-92 53.4 232/234  
:BLT:SWISS 1->241 Y592_PELUB e-116 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21413.1 GT:GENE AAZ21413.1 GT:PRODUCT protein with conserved domain of unknown function DUF28 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 578863..579588 GB:FROM 578863 GB:TO 579588 GB:DIRECTION + GB:PRODUCT protein with conserved domain of unknown function DUF28 GB:PROTEIN_ID AAZ21413.1 GB:DB_XREF GI:71062410 LENGTH 241 SQ:AASEQ MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAIAKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGIIKIDKKEISDEQIFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEKDKVEAALEFLETLEDDDDVQSVYSNINFKNN GT:EXON 1|1-241:0| SW:ID Y592_PELUB SW:DE RecName: Full=UPF0082 protein SAR11_0592; SW:GN OrderedLocusNames=SAR11_0592; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->241|Y592_PELUB|e-116|100.0|241/241| SEG 138->151|iikidkkeisdeqi| SEG 214->228|eaalefletledddd| BL:PDB:NREP 1 BL:PDB:REP 5->212|1lfpA|1e-43|44.7|206/241| RP:PFM:NREP 1 RP:PFM:REP 5->235|PF01709|7e-46|45.5|231/234|DUF28| HM:PFM:NREP 1 HM:PFM:REP 5->236|PF01709|1.3e-92|53.4|232/234|DUF28| RP:SCP:NREP 1 RP:SCP:REP 3->238|1konA|2e-65|36.2|224/233|e.39.1.1| HM:SCP:REP 5->240|1lfpA_|1.3e-88|47.0|236/243|e.39.1.1|1/1|YebC-like| OP:NHOMO 1153 OP:NHOMOORG 1027 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111-1111--111121111111111111111111111111111111111111111111111111111111111111111111-1-----1----111111111111111111111111111122121111111111222222111--111111111-111-111211111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111121112222121111111111111111111111111111111111111111111111111212111111111111111111111111111111111111121212222222222222222222--11111------11111112222222222-2222222222222222222111111112122222222222222122112221-111111111111--12111111111121211111111111111111111111111221111222222222222211111111111112111111111111111111111111111111111111111111111----1-11111111111-11111111111111111121 ------1-------1111111111111111111111-1111111111-111-1111--11-1111111111-11111-1111111111--2111-11111---111-111112111--1111111211-111-11111-111111----11--11--12---1-11-111-11222111111111-1111141221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 96.7 SQ:SECSTR ##ccccccccccccccTTTcHHHHHHHHHHHHHHHHHHHcccGGGcHHHHHHHHHHHHTTccHHHHHHHHHHHHcccccccEEEEEEEEETTTEEEEEEEEEccHHHHHHHHHHHHHHTTcEEccTTccGGGEEEEEEEEEEGGGccHHHHHHHHHHHTccEEEccccEEEEEEcGGGHHHHHHHHHTTTccccEEEEEEEEcccEEcccHHcHHHHHHHHHHHHcccEEEEEEc###### DISOP:02AL 16-17| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHcccccccccccHHHHcccEEEEEEcccccHHHHHHHHHHccccEEEEcccEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHcccccHHHHHcccccccc //