[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21420.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  105/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.18a.118.8e.38.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   195->299 3ee7D PDBj 8e-07 13.6 %
:RPS:SCOP  76->124 1gqeA  e.38.1.1 * 2e-04 28.6 %
:RPS:SCOP  195->291 1ouvA  a.118.18.1 * 5e-04 10.6 %
:HMM:SCOP  199->315 1iygA_ a.118.8.1 * 9.7e-05 20.7 %
:HMM:PFM   61->174 PF02274 * Amidinotransf 0.00068 18.9 95/382  
:BLT:SWISS 26->186 ANR26_MOUSE 2e-05 19.9 %
:BLT:SWISS 199->307 YOPRL_PSEPU 2e-10 31.2 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21420.1 GT:GENE AAZ21420.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 584040..585014 GB:FROM 584040 GB:TO 585014 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE similar to COG1729: Uncharacterized protein conserved in bacteria GB:PROTEIN_ID AAZ21420.1 GB:DB_XREF GI:71062417 LENGTH 324 SQ:AASEQ MFNYKKIIRLKLILVFIFFPNIIFADNHNVNEILELIQKDLKTLEKAVYSGSINSNSQTGTNENSEDVLTRHLLKLSDVEKQFQELTNKFEEINFKLDKLSNRLSKVQADNQIRFQDLENALSSGEIGKKLTSIPKEQVDKTLPGSSQPQDLGSISYKDTESEETSQQIQSVETTASIVTENFESEKNILPNATPEKQYEFATSFLKVGDYSTAERAFREFVINNSEHKLAGNAQYWYAETFRIRQLYTDAATAYLEGYQKYPKGEKAPINLLKLGVSMVQIGEKEQGCKMIVGVEEQYPKANQSVLQKAKYESKKFECSKQNS GT:EXON 1|1-324:0| BL:SWS:NREP 2 BL:SWS:REP 26->186|ANR26_MOUSE|2e-05|19.9|161/1581| BL:SWS:REP 199->307|YOPRL_PSEPU|2e-10|31.2|109/268| COIL:NAA 39 COIL:NSEG 1 COIL:REGION 73->111| RP:PDB:NREP 1 RP:PDB:REP 195->299|3ee7D|8e-07|13.6|103/112| HM:PFM:NREP 1 HM:PFM:REP 61->174|PF02274|0.00068|18.9|95/382|Amidinotransf| RP:SCP:NREP 2 RP:SCP:REP 76->124|1gqeA|2e-04|28.6|49/362|e.38.1.1| RP:SCP:REP 195->291|1ouvA|5e-04|10.6|94/265|a.118.18.1| HM:SCP:REP 199->315|1iygA_|9.7e-05|20.7|111/133|a.118.8.1|1/1|TPR-like| OP:NHOMO 106 OP:NHOMOORG 105 OP:PATTERN -------------------------------------------------------------------- -1------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-----111111111111111111111111-11111111111-11111111111111111-----------------------111------------11--111111111----1------------------------------------------------------11---------------1-----111-1--1-----1111111211------11-------------------------------1----------------------------1------------------------------------------------------------------------------------------------------111--1---------------------------1----------------1----------1------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 31.8 SQ:SECSTR ##################################################################################################################################################################################################cEEEEEEEEccTTTcccccEEEEEEcccccEEEEEEEccccccEE##EEEccccccEEEEEccccEEcTTccEEEEEEEcTTccHHHHHHHHHHHHTTccccccc######################### DISOP:02AL 1-4, 51-70, 120-182, 309-310, 314-317, 320-324| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHcccccHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccc //