[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21453.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:430 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   130->230 2r5tA PDBj 7e-04 32.7 %
:BLT:SWISS 95->237 NU5M_TRYBB 1e-05 27.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21453.1 GT:GENE AAZ21453.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 618580..619872 GB:FROM 618580 GB:TO 619872 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21453.1 GB:DB_XREF GI:71062450 LENGTH 430 SQ:AASEQ MFYSFLIIHLILWTLIPTLTNNNLPLDTIEALAWGSNLDWGFNKHPPASAFFPEVIYQVFGSQDWFYYLLSQLFVVTAFIIVFKFAEELFKNKTLSLISVLLLEGIYFYNFTTPEFNVNVCQLPFWSLCVYYSWKIFDKKVINFKHCFLLGVFAAVGFLSKYLFVYLLISIVLLFFYIIFVKKYQKFDFKYLISFEVFIVLLIPHLIWLTNNDYITITYGLARTGLETSSLLDHITYPLIFLGKQIGILIPFFLMSFFLIKKIKLKVTLKDKKLLFLIFINLIPIGLMFLTSMLTGSKIRTMWMTPFYLFFGVFIIYIFQAQINLKMLNGFISIFLILFIFSPFAYAYISITETDKRTDYLGKEIAIKTEYLWKQNYTLPINVVLGDEWHAGNLSYHLNSRPVWEGVITKDKLNSLSKYICIDNICVGNR GT:EXON 1|1-430:0| BL:SWS:NREP 1 BL:SWS:REP 95->237|NU5M_TRYBB|1e-05|27.2|125/590| TM:NTM 10 TM:REGION 1->23| TM:REGION 66->88| TM:REGION 100->122| TM:REGION 134->156| TM:REGION 160->181| TM:REGION 188->210| TM:REGION 239->260| TM:REGION 274->296| TM:REGION 301->323| TM:REGION 330->352| SEG 6->29|liihlilwtliptltnnnlpldti| SEG 252->287|fflmsfflikkiklkvtlkdkkllflifinlipigl| SEG 331->342|fisiflilfifs| BL:PDB:NREP 1 BL:PDB:REP 130->230|2r5tA|7e-04|32.7|101/284| OP:NHOMO 29 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------112--111112---------------------1------------------------------------------1-------------------------------1-----------------------------------1---------1-------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------111------------------------------------------11111-----------------------------------------------------1------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 23.5 SQ:SECSTR #################################################################################################################################cEEEEEEEEGGGcccccTTcccEEEEEEcccEEEEEEEccccccHHHHHcccHHHHHHHHHHHHHTTcccccccGGGEEEcTTccEEEcccccGGGccccc######################################################################################################################################################################################################## PSIPRED cHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEcccccHHHcccHHHHHHHHHHHEEcccccccc //