[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21457.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  52/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.60.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->176 2hc6A PDBj 2e-06 30.7 %
:RPS:SCOP  35->129 1jyhA  d.60.1.3 * 4e-04 20.9 %
:HMM:SCOP  9->182 2hvaA1 d.60.1.4 * 1.9e-44 34.3 %
:RPS:PFM   26->181 PF04832 * SOUL 5e-23 39.1 %
:HMM:PFM   21->181 PF04832 * SOUL 5e-50 36.0 161/180  
:BLT:SWISS 22->184 HBPL1_ARATH 2e-16 35.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21457.1 GT:GENE AAZ21457.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 622553..623122 GB:FROM 622553 GB:TO 623122 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21457.1 GB:DB_XREF GI:71062454 LENGTH 189 SQ:AASEQ MKKFLSIVFLSLIITSNSMSYEEANYEVVKKNEVYEIRKYSDRLAIETDISNEGNSFRKLFNYISGNNTKNEEIKMTTPVTQMEKKGNMTMQFYLPSRFNKENIPSPSNPDVKILNIKGGYYAVIRYSGRASDKNFIKHKSILENELKKDNMIILSPPIKATYDGPFTLPMNRRNEAMFEINIKNKGEI GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 22->184|HBPL1_ARATH|2e-16|35.2|162/309| BL:PDB:NREP 1 BL:PDB:REP 59->176|2hc6A|2e-06|30.7|114/190| RP:PFM:NREP 1 RP:PFM:REP 26->181|PF04832|5e-23|39.1|156/180|SOUL| HM:PFM:NREP 1 HM:PFM:REP 21->181|PF04832|5e-50|36.0|161/180|SOUL| RP:SCP:NREP 1 RP:SCP:REP 35->129|1jyhA|4e-04|20.9|91/155|d.60.1.3| HM:SCP:REP 9->182|2hvaA1|1.9e-44|34.3|172/0|d.60.1.4|1/1|Probable bacterial effector-binding domain| OP:NHOMO 127 OP:NHOMOORG 89 OP:PATTERN ------------------------------1---1----------1---1------------------ ---------------------1--1-------1111--------------1--11-----------------------------------------------------------------------1--11--1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-11---------11---11111--------------1----1--------------------11--1111-----------1------1-----------------------------11--------------------------------------1--------------------------------------1-------------------11-------1-------------------------------------1------------------------1-----------------------------------------------------------------------------------------------------------------------------------1--------------------1111-1111---------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------412-221-----------------------------1------1--212111--52-------1---114122124333-3333----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 60.3 SQ:SECSTR ##########################################################HHHHHTTTcccccccccccccccEEEEE##EEEEccccHHH#HccccccccccccEEEcccEEEEEEEcccccccHHHHHHHHHHHHHGGGcccccccccEEEccccccc#TTccccE############# DISOP:02AL 1-2, 102-106, 186-189| PSIPRED cHHHHHHHHHHHHcccccccEEcccEEEEEEcccEEEEEEcccEEEEEEEcccccHHHHHHHHHcccccccccccEEccEEEEEEccEEEEEEEEccccccccccccccccEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEcccEEEEEEcccccccccccEEEEEEEEccccccc //