[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21458.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  172/915 : Eukaryota  65/199 : Viruses  0/175   --->[See Alignment]
b.88.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->107 3facH PDBj 1e-26 41.9 %
:RPS:SCOP  1->99 1x6mA  b.88.1.4 * 5e-10 13.5 %
:HMM:SCOP  1->118 1x6mA_ b.88.1.4 * 9.2e-29 29.6 %
:RPS:PFM   27->103 PF04828 * GFA 2e-12 35.1 %
:HMM:PFM   26->103 PF04828 * GFA 1.3e-17 26.9 78/92  
:BLT:SWISS 6->98 CENPV_MOUSE 2e-17 39.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21458.1 GT:GENE AAZ21458.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 623123..623485 GB:FROM 623123 GB:TO 623485 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE similar to protein of unknown function DUF636 GB:PROTEIN_ID AAZ21458.1 GB:DB_XREF GI:71062455 LENGTH 120 SQ:AASEQ MKKLTCHCGEVEAEINMPDNLEKVLKCNCSICKRKGAIMSMVKNEDFKIIKGEDKLKLYQFHSKIAKHYFCSNCGIYTHHNPRANPAMTGFNLGCVDEINTFELENVAVNDGQNHPLDNK GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 6->98|CENPV_MOUSE|2e-17|39.1|92/252| BL:PDB:NREP 1 BL:PDB:REP 3->107|3facH|1e-26|41.9|105/108| RP:PFM:NREP 1 RP:PFM:REP 27->103|PF04828|2e-12|35.1|77/92|GFA| HM:PFM:NREP 1 HM:PFM:REP 26->103|PF04828|1.3e-17|26.9|78/92|GFA| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF04828|IPR006913| GO:PFM GO:0016846|"GO:carbon-sulfur lyase activity"|PF04828|IPR006913| RP:SCP:NREP 1 RP:SCP:REP 1->99|1x6mA|5e-10|13.5|96/196|b.88.1.4| HM:SCP:REP 1->118|1x6mA_|9.2e-29|29.6|115/0|b.88.1.4|1/1|Mss4-like| OP:NHOMO 299 OP:NHOMOORG 237 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1111111----------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-----1-2--1112-1--11111-11111--------121--111-122222221--11-111-11-1----------------------------------------------1--21--1111222223-1111221111111122-111----11-----1-112-12----------------1-11-------------------------12112-----------------------------11--11-----12111111111111-1112--------------1---1-------------------------------1-1-----11111111111111111------------------------------------1-----------------11-111----11-11------1------1-------------1-----121112211211111------------11------------------------------------------------- ----23-----------1----1-11-11-1-------------11-1-1-----1-1--------------------------------------------------112111-22-------1114-154-134-1--1--11-1---1--1111-111--111-----121---------111123-13--21121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 87.5 SQ:SECSTR ##EEEccccccEEEEccTTTTTTccccccTTHHHHcccEEEEEGGGEEEEEcGGGEEEEccTTcccEEEEETTTccEEEEEccccTTEEEEEGGGcTTccGGGGccc############# DISOP:02AL 115-120| PSIPRED cccccEEEEEEEEEEEccccccEEEEEcccHHHHcccEEEEEEcHHEEEEcccccEEEEEccccEEEEEEccccccccEEEccccccEEEEEEEEcccccHHHccccEEccccccccccc //