[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21459.1
DDBJ      :             Phosphoribulokinase/Uridine kinase Family Protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->271 1odfA PDBj 4e-16 32.5 %
:RPS:PDB   19->145 1a7jA PDBj 2e-08 12.5 %
:RPS:SCOP  14->271 1odfA  c.37.1.6 * 4e-25 26.5 %
:HMM:SCOP  8->276 1odfA_ c.37.1.6 * 8e-31 26.3 %
:RPS:PFM   24->141 PF00485 * PRK 9e-11 36.4 %
:HMM:PFM   24->141 PF00485 * PRK 5.9e-09 24.8 113/194  
:BLT:SWISS 21->260 MUG58_SCHPO 1e-27 37.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21459.1 GT:GENE AAZ21459.1 GT:PRODUCT Phosphoribulokinase/Uridine kinase Family Protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 623595..624419 GB:FROM 623595 GB:TO 624419 GB:DIRECTION + GB:PRODUCT Phosphoribulokinase/Uridine kinase Family Protein GB:PROTEIN_ID AAZ21459.1 GB:DB_XREF GI:71062456 LENGTH 274 SQ:AASEQ MIKSFLIPVSFWIAKKVNKKRPLMIGLAGGQGSGKTTISSILTLILKKYFKLNVFKVSIDDFYKTRKDRILLSKNKHPLLMTRGVPGTHDVDLMLNFFKQIKDKNFKSLQIPTFDKAIDDRCQKSLWYKIKTKPDVVIFEGWCVGARAQSSSQLKKPINSLEKVYDQGTKWRTHVNNQLKTKYKTLFKQLDGLLYLKAKNFSLLREWRLKQERKLWVQTKNKKNLKIMSSGDVINFMQTYQRITQQMFKDAIKSSSVIMNLNSNHQIEKIKFKK GT:EXON 1|1-274:0| BL:SWS:NREP 1 BL:SWS:REP 21->260|MUG58_SCHPO|1e-27|37.7|223/277| BL:PDB:NREP 1 BL:PDB:REP 16->271|1odfA|4e-16|32.5|237/280| RP:PDB:NREP 1 RP:PDB:REP 19->145|1a7jA|2e-08|12.5|120/279| RP:PFM:NREP 1 RP:PFM:REP 24->141|PF00485|9e-11|36.4|110/189|PRK| HM:PFM:NREP 1 HM:PFM:REP 24->141|PF00485|5.9e-09|24.8|113/194|PRK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| RP:SCP:NREP 1 RP:SCP:REP 14->271|1odfA|4e-25|26.5|245/280|c.37.1.6| HM:SCP:REP 8->276|1odfA_|8e-31|26.3|251/0|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 181 OP:NHOMOORG 157 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1111111--11-1111-1---1111111111111111---------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------1111--------------------------------------------------------11--------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------1-12-11-----------------------1---------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------11----------------------------------------------------------------------- ------------111111111111311111-1111111-111111121121222--11111111111111111111111111111111-14111112221111111---------------------------------------------------------------------1-1-91-111112-111--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 93.1 SQ:SECSTR ###############TTcTTccEEEEEcccccTHHHHHHHHHHHHTccEcccHEEEEEGGGGccccHHHHHHHHHHTcTTccTTcGGGccHHHHHHHHHHHHHHEEcccEEccccccccccTTccccEEccccccEEEEEEccTTc###TccGGGccccccTTTcccccTTHHHHHHHHHHHHHHTTTcTTEEEETEEccTTHHHHHHHHHHHHHHHHT#HHHHcccccHHHHHHHHHTTHHHHHHHHHHHHHHTcEEEEEcTTccEEEEEEEc DISOP:02AL 274-275| PSIPRED ccHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHccccHHccccccccccHHHHHHHHHHHHcccccEEEEEEEEccccccccccccEEEEccccEEEEEccHHccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccHHHHcccccccEEEEEEcccccEEEEEEcc //