[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21490.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  180/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->234 PF07103 * DUF1365 5e-45 42.0 %
:HMM:PFM   5->244 PF07103 * DUF1365 2.7e-79 39.5 238/254  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21490.1 GT:GENE AAZ21490.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 655546..656313 GB:FROM 655546 GB:TO 656313 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE similar to protein of unknown function (DUF1365) GB:PROTEIN_ID AAZ21490.1 GB:DB_XREF GI:71062487 LENGTH 255 SQ:AASEQ MIKNSYIYTGNVIHKRFKPKIHSFNYNVFSLLIDLSEVDLLHKSLKIFSYNKLNIISFFDKDHGARDGSSLKEWVLGNLRKNNIDTNDVHIKLLCYPRIFGYVFNPLSVFYVYDKNFDLISILYEVKNTFGEQHVYVFKTKKDQNLIQHMCKKKFHVSPFIEMNCIYFFRLLKPGNKISVIIDLNDPVGKVLYASQDGIKSELTNRNLLKSYLKHPLMTFKIIIAIHYEAFKLWTKGIKFIKKKLNIKNNITIEN GT:EXON 1|1-255:0| SEG 236->254|kgikfikkklniknnitie| RP:PFM:NREP 1 RP:PFM:REP 7->234|PF07103|5e-45|42.0|226/250|DUF1365| HM:PFM:NREP 1 HM:PFM:REP 5->244|PF07103|2.7e-79|39.5|238/254|DUF1365| OP:NHOMO 195 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- ----1------------11-11--1-1111111111-111-------------11--1----1---1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------1-11---11111---------------------11--111-1-111--1-11111-1111111--------1-----11-----------------------------1--1--1----------1----111-------111-1---1---1111111----1-1---111-----------11--11111----------------1--------1--------------------------11-111111111111111-111111--1-1----111---------1-11------------------------------11111--------------------------------------------1----------1111---------------11--1-1---------11111111111111---11----111-11111111111111111-11--------11----------------------------------------------------- ----11------1111-1---------------------------------------1-----------------------------------------1-1------------------------------------------------------------------------------111-----1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 247-255| PSIPRED cccccEEEEEEEEEEEccccEEEEEEEEEEEEEEHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEEEcccccEEEccEEEEEEEEccccEEEEEEEEEcccccEEEEEEEccccccEEEEEEcEEEEccccccccccEEEEEEccccEEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcc //