[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21491.1
DDBJ      :             Cyclopropane-fatty-acyl-phospholipid synthase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  483/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:392 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   122->389 1kpiA PDBj 9e-32 33.5 %
:RPS:PDB   127->392 2eg5A PDBj 1e-33 8.0 %
:RPS:SCOP  130->390 1kp9A  c.66.1.18 * 2e-68 28.1 %
:HMM:SCOP  115->391 1kpgA_ c.66.1.18 * 1.6e-68 30.4 %
:RPS:PFM   119->386 PF02353 * CMAS 3e-68 43.8 %
:HMM:PFM   117->387 PF02353 * CMAS 2.1e-86 35.6 270/273  
:BLT:SWISS 46->386 CFA_ECOLI 2e-44 36.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21491.1 GT:GENE AAZ21491.1 GT:PRODUCT Cyclopropane-fatty-acyl-phospholipid synthase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 656313..657491 GB:FROM 656313 GB:TO 657491 GB:DIRECTION + GB:PRODUCT Cyclopropane-fatty-acyl-phospholipid synthase GB:NOTE cfa-like protein GB:PROTEIN_ID AAZ21491.1 GB:DB_XREF GI:71062488 LENGTH 392 SQ:AASEQ MLIYKISDLIVFSALKNIKHGFLEIKKVNGEVLKFGNPDENLKVFLEIKDESLNYNLIKSGSIGLGESYMKDLFITNNLSDLIELTAKNIKTIYKFSGIFDLPFINFIKNKIIKNTKNRSKENIAKHYDLGNDFFSLWLDKTLTYSSAIFESPKQELFEAQNNKYQKLIDLIRPSSGNKILEIGCGWGGFAEYLGTNYDVKLDCITISKKQYEFAKERIHRCGLNEKVNIQIKDYRDLKDKYDHIASIEMIEAVGQNYLDSYFNTIKNNLTPSGTVGIQAITIDDSLFNRYKNKKDFIQQYIFPGGFLPSKSELQNYVDKNGLKFGEYNSYANHYSETLIIWREIFIKKWDLIKKQGFDLKFKKMWEFYLSYCEAGFKSKNIDLIQFSLQNK GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 46->386|CFA_ECOLI|2e-44|36.9|309/382| SEG 104->118|finfiknkiikntkn| BL:PDB:NREP 1 BL:PDB:REP 122->389|1kpiA|9e-32|33.5|260/291| RP:PDB:NREP 1 RP:PDB:REP 127->392|2eg5A|1e-33|8.0|261/344| RP:PFM:NREP 1 RP:PFM:REP 119->386|PF02353|3e-68|43.8|267/271|CMAS| HM:PFM:NREP 1 HM:PFM:REP 117->387|PF02353|2.1e-86|35.6|270/273|CMAS| GO:PFM:NREP 1 GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF02353|IPR003333| RP:SCP:NREP 1 RP:SCP:REP 130->390|1kp9A|2e-68|28.1|260/270|c.66.1.18| HM:SCP:REP 115->391|1kpgA_|1.6e-68|30.4|276/285|c.66.1.18|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1068 OP:NHOMOORG 597 OP:PATTERN -------------------------------------------------------------------- 1---42-1222132388AA-A555B8A9AAA867771454-332---------23--2--112--121131-111111-----11----------------------------------------22-222111-2111-------1------11-----------1--1-------------111--------111111-21-21--2------1-------------------------------------11211111111221111111111-11111----------------------------------111-------121111111-1--1221111-1----------------------------2224-----111331112222211-11111112---1--1--242-2334122322222211111111111121111111151111-22-----------------------------222321211-11111114111122212222122221211-11231224242221132121-322----------121--21121-1----------121-111-1-3111----11111-1-1111111-----1111-121121111111111-111111--1-1----222------11132221111111111-111111111111111111122222111111111111111111121111111--111111111111---3-----111112121---------------22--2-211111111132222222221221-1-11-1---11111111111112222222222--------22----------------------------------------------------- ----131-2---2333323211133331111-111-1111-11-11442233331331232311111111--111------11111---38533461113123111-12------------------------------------------------------21------112-1222E22212322C3622141112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 69.9 SQ:SECSTR ######################################################################################################################EHHHHcccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccTTccHHHHHHTHHHHHHHHHHHHcccTTcEEEEEccccTTcccccTTcEEEEEEEccTTcccGGGTTcccTTcTTcccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEcccTTcccHHcccccTTTTcccccccccHHHHHHHHHHHccEEEEEEEEEEEETTTTcccTHHHHHHHHHGGGHHHHHHHHHHHHHHHGGGTccEEccccEEEEEEEEEEc PSIPRED cHHHHHHHHHHHHHHHHcccccEEEEEccccEEEccccccccEEEEEEccHHHHHHHHcccccccHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHcccccEEEEHHHHHHccHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccccccccEEEccccccccHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEc //