[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21497.1
DDBJ      :             conserved hypothetical Cytosolic Protein
Swiss-Prot:Y678_PELUB   RecName: Full=UPF0061 protein SAR11_0678;

Homologs  Archaea  3/68 : Bacteria  434/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
a.211.1c.51.6
:483 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   72->359 3dnuA PDBj 8e-28 8.5 %
:RPS:SCOP  183->262 1vj7A1  a.211.1.1 * 7e-10 15.0 %
:RPS:SCOP  273->457 2i9iA1  c.51.6.1 * 8e-16 8.0 %
:RPS:PFM   46->457 PF02696 * UPF0061 2e-97 46.3 %
:HMM:PFM   20->457 PF02696 * UPF0061 3.3e-105 36.3 432/487  
:BLT:SWISS 1->483 Y678_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21497.1 GT:GENE AAZ21497.1 GT:PRODUCT conserved hypothetical Cytosolic Protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(660987..662438) GB:FROM 660987 GB:TO 662438 GB:DIRECTION - GB:PRODUCT conserved hypothetical Cytosolic Protein GB:NOTE similar to Bacillus cereus ATCC 14579 sp|Q813A5|YY99_BACCR hypothetical UPF006 GB:PROTEIN_ID AAZ21497.1 GB:DB_XREF GI:71062494 LENGTH 483 SQ:AASEQ MTIGWHFDNSYSRLPKTFKENINPVAVNAPEILILNKDLANKLDLDFSNINDDDLSKIFSGNLLPEGSNSIAQAYAGHQFGHFTMLGDGRAVLIGEHLTKNNERFDIQFKGSGRTPFSRSGDGRAVLGPMLREYIISEAMHFLKIPTTRSLAVVKTGEDVVREQISQGAILTRVALGHLRVGTFQYIAAKQNISDLEILINYTIEKYYPNIKSSKNKALDLLNVLIEKQTQLVIDWMRVGFIHGVMNTDNMSISGETIDYGPCAFMDVYDPKTVFSSIDQLGRYAYENQPKITKWNLTRFAECLIPLISTNEDEAIKLATEALDKFEQNYETKWLNMMRDKLGLYGEDKEDKNLIMELLNWMKEKKADYTNTFIFLMNKTIKNSEVYDNADFDLWKTKWMKRLVMFGNTHDKSVDLMSSCNPMVIPRNHKIEEALMLANNGDLTLFNKLIKILKNPYLVNNGDLELMSPAPHSDEKYQTFCGT GT:EXON 1|1-483:0| SW:ID Y678_PELUB SW:DE RecName: Full=UPF0061 protein SAR11_0678; SW:GN OrderedLocusNames=SAR11_0678; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->483|Y678_PELUB|0.0|100.0|483/483| SEG 32->45|ililnkdlankldl| RP:PDB:NREP 1 RP:PDB:REP 72->359|3dnuA|8e-28|8.5|272/401| RP:PFM:NREP 1 RP:PFM:REP 46->457|PF02696|2e-97|46.3|406/457|UPF0061| HM:PFM:NREP 1 HM:PFM:REP 20->457|PF02696|3.3e-105|36.3|432/487|UPF0061| RP:SCP:NREP 2 RP:SCP:REP 183->262|1vj7A1|7e-10|15.0|80/172|a.211.1.1| RP:SCP:REP 273->457|2i9iA1|8e-16|8.0|176/221|c.51.6.1| OP:NHOMO 702 OP:NHOMOORG 602 OP:PATTERN ----------------------------1-11------------------------------------ -----1111111-1-11----1--11-----11111-111----1-11----11--1------------------------------------------1-1----1---------------------------------------3211111--11121211111111111221111211111--------1-11111111111111111----111-111--1------111------------------------------------------------------------------------------------------11-11111111111-----1111-----------1--------------1-11221-----1-11111-11111------------22122222----11111111111111111111111111111111111-111---------------------------------11111-111111111111111111111111111111111111111111112111111111111---------111111-1-111---1-----------1-----11--1-----------------------111111131112121111112111111111111---2111------1111-111111111111-1111111-1111111111111111---11-111111111111111121111--1---122-1111-------------11111---------------111111111111111111111111111111111-1111111111111111111111111111111111-1-11----------------------------------------------------- ------1-----222111111111-1111111111111111111111111111111111111111111111111111111111112-1-111111111111-1111-27142521311-1-11111-112A1-112-11-11-21-111-1--1122131211321-------521231J1121211111112112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 403 STR:RPRED 83.4 SQ:SECSTR #######################################################################EccHHHHHHHHHTTcccccccccccccEEEEEETTEEEEEcTTccccEEEEccccTTHHHHHHHHHHHHHHTTcccccEEEEEETTEEEEEEHHHHHHHHEcccEEEcTTcccEEEccEEEHHHTTccGGGccGGGTcccHHHTTcHHHHHHHTcTTHHHHHHHHHHHHHHHHTTcccccGcEEEEcGGGcEEEcccccccccGGGTTTccccGGGcEEEEEEETTEEEEEGGHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHGGGccTccTccHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHcTTccccccccccccccccccHHHHHHcccHHHHHHHHcHHHHHHHHHHccccEE####EEcTTTHHHHHHcTTcccHH###HHHHHHHHHHHHTTTcc## DISOP:02AL 382-383| PSIPRED ccccccccccHHHcccccccccccccccccEEEEEcHHHHHHccccHHHcccHHHHHHHccccccccccHHHHHcccEEcccccccccccEEEEEEEEcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccEEEcccccccEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccEEHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHccccccccccccEEccc //