[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21505.1
DDBJ      :             Integral membrane protein DUF6
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:228 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->79 1s7bA_ f.39.1.1 * 1.6e-10 25.0 %
:HMM:PFM   4->71 PF00892 * EamA 5.8e-12 29.4 68/126  
:HMM:PFM   88->127 PF12159 * DUF3593 9.9e-05 35.0 40/93  
:BLT:SWISS 1->54 TMM20_MOUSE 4e-04 40.0 %
:BLT:SWISS 102->166 FTSK_BACSU 8e-05 35.9 %
:BLT:SWISS 146->191 EPA4B_XENLA 5e-04 41.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21505.1 GT:GENE AAZ21505.1 GT:PRODUCT Integral membrane protein DUF6 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 670773..671459 GB:FROM 670773 GB:TO 671459 GB:DIRECTION + GB:PRODUCT Integral membrane protein DUF6 GB:PROTEIN_ID AAZ21505.1 GB:DB_XREF GI:71062502 LENGTH 228 SQ:AASEQ MSGVIGGTGLGIAMITFIYSITNTSAAVTLLCLAAMPFFTALLGFLFLKEKISLNVWIAIFIATVGIIIIAIGNTEKNSLLGLIFGMTSSIGFSVFSVTLRWKKETPKFTTVAFAGLFCFVVAAIVILSNDMVFLSSSYNGALFSIHGTLVCMGLILYSIGSKAIPAAELTLLSLTEVIGGIFWVWVPILGINEIPSTNTIIGGFFLFMSIIYYSLTIKTNRRFIALN GT:EXON 1|1-228:0| BL:SWS:NREP 3 BL:SWS:REP 1->54|TMM20_MOUSE|4e-04|40.0|50/368| BL:SWS:REP 102->166|FTSK_BACSU|8e-05|35.9|64/787| BL:SWS:REP 146->191|EPA4B_XENLA|5e-04|41.3|46/985| TM:NTM 8 TM:REGION 1->23| TM:REGION 27->49| TM:REGION 52->73| TM:REGION 78->99| TM:REGION 110->132| TM:REGION 141->163| TM:REGION 169->191| TM:REGION 198->219| SEG 58->72|iaifiatvgiiiiai| HM:PFM:NREP 2 HM:PFM:REP 4->71|PF00892|5.8e-12|29.4|68/126|EamA| HM:PFM:REP 88->127|PF12159|9.9e-05|35.0|40/93|DUF3593| HM:SCP:REP 4->79|1s7bA_|1.6e-10|25.0|76/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 6 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------------2---------------------------------------------------1-----------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHEEHHHccccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHEEEEccEEEEEc //