[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21510.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:310 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   224->300 2zzjA PDBj 3e-05 31.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21510.1 GT:GENE AAZ21510.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(675167..676099) GB:FROM 675167 GB:TO 676099 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to hypothetical protein EBAC750-09G06.38 from uncultured bacterium 314 GB:PROTEIN_ID AAZ21510.1 GB:DB_XREF GI:71062507 LENGTH 310 SQ:AASEQ MKKIIFLLIITLLFANNSYAKKKYFKENYIFKPDQKIKWLEDVGTWSKNWRTHGWQSNAPWALRYSKDIVRDGEYSLRFEKRKDDCGPKKNKGDCKRTSEKWIGRSEIIMDYPKSMGETGNQWYSWSIYIPKESNRPKNIDGQIILGQFKTHNKHLSKTRKYVVGGKNKNDSNCTEISLTIRLNKDGLMSDRSGVTYCNSWHKDNISLHKKFYQKLVDIDDVRGKWHDIILHANWTDNDEGFFKIWVNSELKLDHKGKTLSKVMTIDGKKHGPMFRFGVYSQKWTGTTIAYYDSISRADTCEKLIRCNIK GT:EXON 1|1-310:0| SEG 4->14|iiflliitllf| BL:PDB:NREP 1 BL:PDB:REP 224->300|2zzjA|3e-05|31.9|72/238| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 23.2 SQ:SECSTR ###############################################################################################################################################################################################################################TccEEEEEEEEEcccTTEEEEEEETTEEE##EEEEEEccccccccEE###EEEEEEEcHHHcccEEEEEEEEEEEcc########## DISOP:02AL 83-92| PSIPRED cHHHHHHHHHHHHHHcccHHHHHcccccEEEccccccccHHHHHHHHHHHHcccccccccEEccccccHHHcccHHEEEEEEcccccccccccccccccccccccEEEEEcccccccccccEEEEEEEEEEcccccccccccEEEEEEEEcccccccccccEEEEccccccccHHHEEEEEEcccccccccccccEEcccccccccccccccEEEEEEcHHHccEEEEEEEEEEEccccccEEEEEEccEEEEEccccccccEEEEEccccccEEEEEEEEccccccEEEEEEEEHHHHHHHHHHEEccc //