[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21513.1
DDBJ      :             HI0933-like protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  552/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
c.3.1e.74.1
:393 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->387 2gqfA PDBj 2e-82 47.6 %
:RPS:PDB   3->393 1d4cB PDBj 2e-19 16.4 %
:RPS:SCOP  2->191 2gqfA1  c.3.1.8 * 2e-45 39.5 %
:RPS:SCOP  191->337 2gqfA2  e.74.1.1 * 8e-38 38.6 %
:RPS:SCOP  329->391 2gqfA1  c.3.1.8 * 2e-24 60.3 %
:HMM:SCOP  1->393 1kf6A2 c.3.1.4 * 2.2e-30 23.2 %
:RPS:PFM   17->391 PF03486 * HI0933_like 1e-84 46.8 %
:HMM:PFM   5->392 PF03486 * HI0933_like 2.7e-144 45.5 387/409  
:BLT:SWISS 3->380 YHIN_ECOLI 2e-97 49.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21513.1 GT:GENE AAZ21513.1 GT:PRODUCT HI0933-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 677178..678359 GB:FROM 677178 GB:TO 678359 GB:DIRECTION + GB:PRODUCT HI0933-like protein GB:PROTEIN_ID AAZ21513.1 GB:DB_XREF GI:71062510 LENGTH 393 SQ:AASEQ MTEQFDVIVVGAGAAGMMSAIEAGKRGRKVLLVDHAKKIGEKIRISGGGRCNFTNIHTHPSKFISNNPKFVISALKQYTQNNFIDLIKKHNIKFHEKKLGQLFCDESAQQIIDMLLLECEMAKVVLKKDTTIDDIDKQDDNYFIVVGSDKYFSQSLIIATGGLSIPKIGASKFGYDIAQKFGLKVIETLPALVPLTFSEKILAICKELTGLSVEAVVSFKKTFFEEGMLFTHRGLSGPSILQISSYWKLGDNIKVNLSPKLDVDKFLNDRKISSPKQDIGIIVSEILPKRLAHIICNENNVNGNICELSNKVLTSLSNSINAWVINPIGTEGYRTAEVTLGGIDTEEISSKTMMSNKHPGLFFIGEVVDVTGHLGGYNFQWAWSSGYVAGQYA GT:EXON 1|1-393:0| BL:SWS:NREP 1 BL:SWS:REP 3->380|YHIN_ECOLI|2e-97|49.5|378/400| SEG 7->16|vivvgagaag| SEG 127->140|kkdttiddidkqdd| BL:PDB:NREP 1 BL:PDB:REP 17->387|2gqfA|2e-82|47.6|361/394| RP:PDB:NREP 1 RP:PDB:REP 3->393|1d4cB|2e-19|16.4|385/566| RP:PFM:NREP 1 RP:PFM:REP 17->391|PF03486|1e-84|46.8|370/394|HI0933_like| HM:PFM:NREP 1 HM:PFM:REP 5->392|PF03486|2.7e-144|45.5|387/409|HI0933_like| RP:SCP:NREP 3 RP:SCP:REP 2->191|2gqfA1|2e-45|39.5|190/253|c.3.1.8| RP:SCP:REP 191->337|2gqfA2|8e-38|38.6|145/148|e.74.1.1| RP:SCP:REP 329->391|2gqfA1|2e-24|60.3|63/253|c.3.1.8| HM:SCP:REP 1->393|1kf6A2|2.2e-30|23.2|233/312|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 627 OP:NHOMOORG 576 OP:PATTERN --------------------------------11---------11111-------------------- 111---------------------------------------------------------------------------1--1-----------------111111111-1--------------111111-11111-----222--111-111--11111111111-11111111111111-1-------2111111111111111112111111111111111111111111121111111111211111111----------------------11111111111111111111111111111111111111111111111-222222222222221222233322122-221-2222-1-11-111---11-1111---------------1---11111-11111-----------1-111111111111--1-11111111111111111111111-11------------------------------11111-111111111111111111111111-11111111111111111111111-11-----1--------111111--1-11111111111-------1-------1-321-----------------32113--11-111111111111111111111111111--1111-------1111-111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----1111-111111-111111-1111111111111111-111111111111111111-2--111-1111111111111111111111111------1-111-11----------1---------------------------1--------1- ------------------------------------------------------------------------------------------------------------21-----------------------------------------------------------------111--111111--1-11111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 393 STR:RPRED 100.0 SQ:SECSTR ccEEccEEEEcccHHHHHHHHHHHHHTccEEEEcccccccTTGGGccccEEccccHHHHHHTTccccHHHHHHHHHHHTTTHHHHHHHHTTccccEEEccTTcccccEEEHHHHHHHHHHHTTcEEEccEEEEEEEEcccccEEEEEEEEEEccEEEEccccEEcccTTcccHHHHHHHTTTccEEcTTcEEEEEEEcTTcccccTHHHHTTcEEEcccccccccTTccHHHHHHHHHTcTTccEEEEEEHHHHHHcTHHHHHHHTTccEEEccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHTccccccccccccccccccEEEEEEEEEEEEEccEEEccTEEEcTTTccEEEEEEEccTTEcTTcccTTHHHHHHHHHHHHHHHHH DISOP:02AL 1-2, 270-280| PSIPRED ccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccEEccccEEEEccccccHHHHccccHHHHHHHHHHccHHHHHHHHHHcccEEEEEcccccEEcccHHHHHHHHHHHHHHcccEEEEccEEEEEEEEcccEEEEEccEEEEEEEEEEEccccccccccccHHHHHHHHHcccEEEcccccEEcEEcccHHHHHcccccccccHHEEEcccEEEEccEEEEEccccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHccEEEEEccccHHHHHHHcccccHHHccHHHHHHHccccEEEEEEEEEccccccHHHHHHHHHHHHHHHccc //