[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21531.1
DDBJ      :             hypothetical SurA-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   202->246 2bjrB PDBj 2e-04 13.3 %
:RPS:SCOP  200->246 1m5yA2  d.26.1.1 * 2e-07 27.7 %
:HMM:SCOP  159->260 1pinA2 d.26.1.1 * 1.8e-16 29.0 %
:RPS:PFM   212->246 PF00639 * Rotamase 2e-04 45.7 %
:HMM:PFM   178->259 PF00639 * Rotamase 3.8e-14 34.1 82/95  
:BLT:SWISS 87->165 TIG_MYCMO 7e-04 31.6 %
:BLT:SWISS 200->246 SURA_BORA1 2e-05 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21531.1 GT:GENE AAZ21531.1 GT:PRODUCT hypothetical SurA-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(694313..695230) GB:FROM 694313 GB:TO 695230 GB:DIRECTION - GB:PRODUCT hypothetical SurA-like protein GB:PROTEIN_ID AAZ21531.1 GB:DB_XREF GI:71062528 LENGTH 305 SQ:AASEQ MKKKILIFLFVIICFHAQSIETKIIHNIQDEIITNIDIKNEFKYLVALNNSLKELDQEKILNISNESIIREKIKKIEISKNFKEIKLNEDYSELLLKNIYSRLNLKSINEFEIYLKDYDLKISDIEKKITIDALWNELIIKKYSSKVVINEAVLKEELLKNNKIESKEYQLSEIIFEVKNKEEIEKKYKEVVKSINEIGFENSAATYSFSDSAKIGGDIGWINENSLNNNIRKNISSLKVGEFTKPIILSNGILILKLINIKSSETTIDIENELKKAINYERNRQLNQYSKIYYNKIKKNLDFNG GT:EXON 1|1-305:0| BL:SWS:NREP 2 BL:SWS:REP 87->165|TIG_MYCMO|7e-04|31.6|76/483| BL:SWS:REP 200->246|SURA_BORA1|2e-05|38.3|47/506| TM:NTM 1 TM:REGION 5->27| SEG 2->13|kkkiliflfvii| SEG 62->86|nisnesiirekikkieisknfkeik| SEG 173->193|eiifevknkeeiekkykevvk| SEG 247->264|iilsngililklinikss| SEG 291->300|kiyynkikkn| RP:PDB:NREP 1 RP:PDB:REP 202->246|2bjrB|2e-04|13.3|45/350| RP:PFM:NREP 1 RP:PFM:REP 212->246|PF00639|2e-04|45.7|35/91|Rotamase| HM:PFM:NREP 1 HM:PFM:REP 178->259|PF00639|3.8e-14|34.1|82/95|Rotamase| GO:PFM:NREP 1 GO:PFM GO:0016853|"GO:isomerase activity"|PF00639|IPR000297| RP:SCP:NREP 1 RP:SCP:REP 200->246|1m5yA2|2e-07|27.7|47/107|d.26.1.1| HM:SCP:REP 159->260|1pinA2|1.8e-16|29.0|100/119|d.26.1.1|1/1|FKBP-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 14.8 SQ:SECSTR #########################################################################################################################################################################################################cEEEEEEcccTTTccEEEEEEEHHHHTcccEEcccccTTcccEEE########################################################### DISOP:02AL 45-62| PSIPRED cHHHHHHHHHHHHHHHHccccccEEEEEccEEccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccEEEEEEEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHcccccccccccccHHHHHHHHHcccccccccEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //