[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21533.1
DDBJ      :             Predicted permease YjgP/YjgQ family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:357 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->349 PF03739 * YjgP_YjgQ 1.7e-31 17.3 335/355  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21533.1 GT:GENE AAZ21533.1 GT:PRODUCT Predicted permease YjgP/YjgQ family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(697671..698744) GB:FROM 697671 GB:TO 698744 GB:DIRECTION - GB:PRODUCT Predicted permease YjgP/YjgQ family protein GB:PROTEIN_ID AAZ21533.1 GB:DB_XREF GI:71062530 LENGTH 357 SQ:AASEQ MKTYIKFLINLFNISLLKIFITFFIIILITNILEQIEFFKNIDLSFFYLFFLSLLNTPSVLFEILPFIFLLGTQVFFIHLIDKNELQVFKYSGLNNIKIIKILGLYSFILGIIMVIFFYNGSSILKNSYLLIKNNYSGDNKYLAVITENGLWIKDEINDNINIINARQVNNEFLLNVSITKFNKDFDLVEVLQSERVDITSKKWKIFNPITLKGNSQSTLNELILHSNFDLQKINSLFSNLSSLSIIDLITLRKSYMSLNYSVTDINSHLLKIVSYPVYLTLITIFSAIIMFNIGYQKNTFYKITLGIFLSVIIYYINNFLSVLGTNEKIPVTLSIFLPLIILSIINFISIIKLNEK GT:EXON 1|1-357:0| TM:NTM 6 TM:REGION 8->30| TM:REGION 52->74| TM:REGION 99->121| TM:REGION 271->293| TM:REGION 301->323| TM:REGION 332->354| SEG 14->33|isllkifitffiiilitnil| SEG 44->55|lsffylfflsll| SEG 93->105|glnnikiikilgl| SEG 157->165|indniniin| SEG 234->252|inslfsnlsslsiidlitl| SEG 334->355|lsiflpliilsiinfisiikln| HM:PFM:NREP 1 HM:PFM:REP 9->349|PF03739|1.7e-31|17.3|335/355|YjgP_YjgQ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 135-146| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccEEEEccccccEEEEEEEccccEEEEEEEEEEcccccEEEEEEEcEEEEEccEEEEEEEEEEccccHHHHcccEEEEcccHHHHHHHHccccEEEHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHEEccc //