[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21543.1
DDBJ      :             NADH-ubiquinone oxidoreductase 17.2 kD subunit of complex I
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  102/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:RPS:PFM   29->103 PF05071 * NDUFA12 4e-13 50.7 %
:HMM:PFM   27->117 PF05071 * NDUFA12 7.1e-28 48.9 90/105  
:BLT:SWISS 14->103 NDUAC_DICDI 3e-12 37.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21543.1 GT:GENE AAZ21543.1 GT:PRODUCT NADH-ubiquinone oxidoreductase 17.2 kD subunit of complex I GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 707855..708214 GB:FROM 707855 GB:TO 708214 GB:DIRECTION + GB:PRODUCT NADH-ubiquinone oxidoreductase 17.2 kD subunit of complex I GB:PROTEIN_ID AAZ21543.1 GB:DB_XREF GI:71062540 LENGTH 119 SQ:AASEQ MLTLLKKIFIWWNQETLGTKLKTIFYGKLAGKDSSGNKYYESKSGKRWVIYNDEIDASKIPNEWFSWMHFTNNRIENNHELKKYDWQKPHQSNQTGTENAYHPNKNNDPIKKKYTIWKS GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 14->103|NDUAC_DICDI|3e-12|37.8|90/138| RP:PFM:NREP 1 RP:PFM:REP 29->103|PF05071|4e-13|50.7|75/103|NDUFA12| HM:PFM:NREP 1 HM:PFM:REP 27->117|PF05071|7.1e-28|48.9|90/105|NDUFA12| GO:PFM:NREP 3 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF05071|IPR007763| GO:PFM GO:0009055|"GO:electron carrier activity"|PF05071|IPR007763| GO:PFM GO:0016020|"GO:membrane"|PF05071|IPR007763| OP:NHOMO 123 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111-1111111111-11111111111111111111111111111111111111111111111111-1111---11111--11-------------111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11------111----------------------------------------------------------------------------------11--------------------------------------------------------111----1111-211----1-1--------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHccHHHHHHHHHHHccEEEEEEccccEEEEccccEEEEEEccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHcc //