[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21544.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   47->134 PF09923 * DUF2155 1e-17 42.9 %
:HMM:PFM   43->134 PF09923 * DUF2155 4.1e-30 40.4 89/90  
:BLT:SWISS 43->135 Y359_RICPR 6e-10 30.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21544.1 GT:GENE AAZ21544.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 708174..708581 GB:FROM 708174 GB:TO 708581 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to Caulobacter crescentus CB15 gi|25397377|pir||A87483 hypothetical protein CC1 GB:PROTEIN_ID AAZ21544.1 GB:DB_XREF GI:71062541 LENGTH 135 SQ:AASEQ MILLKKNIQSGKVSFLFLLIYFFLTSLSSPLIANENNEGKFVEIKILDKVSSKTDLLKLKIGEELRFKSLLIKSLKCKNSEFDDNPEITVYIQVKDTIKNDNNEVFIFNGWTFSSSPAVNPFDHPVYDIWLTRCY GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 43->135|Y359_RICPR|6e-10|30.4|92/100| TM:NTM 1 TM:REGION 7->29| RP:PFM:NREP 1 RP:PFM:REP 47->134|PF09923|1e-17|42.9|84/89|DUF2155| HM:PFM:NREP 1 HM:PFM:REP 43->134|PF09923|4.1e-30|40.4|89/90|DUF2155| OP:NHOMO 70 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11111111111111111111111111111-111111111111111111111111-1111---111--1--------------1-1--------------11-------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 3-7| PSIPRED cEEEEcccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEEEccccEEEEEEEEcccEEEEEEEEEEEEEcccccccccccccEEEEEEEEEEcccccEEEEEEEEEEEccccccccccEEEEEEEEEc //