[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21555.1
DDBJ      :             Predicted molecular chaperone distantly related to HSP70-fold metalloproteases
Swiss-Prot:ANMK_PELUB   RecName: Full=Anhydro-N-acetylmuramic acid kinase;         EC=2.7.1.n1;AltName: Full=AnhMurNAc kinase;

Homologs  Archaea  1/68 : Bacteria  437/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
c.55.1d.211.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->369 3cqyB PDBj 2e-35 37.0 %
:RPS:PDB   8->371 3cqyA PDBj 6e-55 34.1 %
:RPS:SCOP  81->134 1s70B  d.211.1.1 * 6e-04 31.9 %
:RPS:SCOP  169->322 1bo5O2  c.55.1.4 * 2e-04 12.0 %
:HMM:SCOP  5->352 1huxA_ c.55.1.5 * 2.3e-13 19.9 %
:RPS:PFM   8->371 PF03702 * UPF0075 7e-53 37.2 %
:HMM:PFM   8->372 PF03702 * UPF0075 7.7e-75 32.7 349/364  
:BLT:SWISS 1->375 ANMK_PELUB 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21555.1 GT:GENE AAZ21555.1 GT:PRODUCT Predicted molecular chaperone distantly related to HSP70-fold metalloproteases GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 720637..721764 GB:FROM 720637 GB:TO 721764 GB:DIRECTION + GB:PRODUCT Predicted molecular chaperone distantly related to HSP70-fold metalloproteases GB:PROTEIN_ID AAZ21555.1 GB:DB_XREF GI:71062552 LENGTH 375 SQ:AASEQ MEKFYTSLGLMSGTSMDGVDASIIRSDGESNYEPIFDKYFEYDGVIYSNLLNLRDKINSIKDLQDNSYQINELERKITLFHAKISKEIIKNAGVDVDIVGFHGQTIFHNAQEKISKQIGDGNLLSSLLKKNVVYNFRENDIHNGGQGAPLAPIFHNLLINQNKIEKPACVLNIGGIANITLVISKNNEDLKSFDVGPGNCLLDEWVRRHTQMKYDENGKASNLGKTSEVILNQAIDNFDNISNQKKLSFDIKDFDLSFVKGLTYEDGLSTLVDFTAIIIYQSILKSINSEENKKLLIIVCGGGRKNLSLMESIRKRLPKNIYLKIIDDYKVDGDFIESQAFAYLAIRSALKKVISFPNTTNVKKPSIGGVLVKNY GT:EXON 1|1-375:0| SW:ID ANMK_PELUB SW:DE RecName: Full=Anhydro-N-acetylmuramic acid kinase; EC=2.7.1.n1;AltName: Full=AnhMurNAc kinase; SW:GN Name=anmK; OrderedLocusNames=SAR11_0736; SW:KW ATP-binding; Carbohydrate metabolism; Complete proteome; Kinase;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->375|ANMK_PELUB|0.0|100.0|375/375| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 11->369|3cqyB|2e-35|37.0|335/363| RP:PDB:NREP 1 RP:PDB:REP 8->371|3cqyA|6e-55|34.1|343/364| RP:PFM:NREP 1 RP:PFM:REP 8->371|PF03702|7e-53|37.2|347/365|UPF0075| HM:PFM:NREP 1 HM:PFM:REP 8->372|PF03702|7.7e-75|32.7|349/364|UPF0075| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF03702|IPR005338| GO:PFM GO:0006040|"GO:amino sugar metabolic process"|PF03702|IPR005338| GO:PFM GO:0009254|"GO:peptidoglycan turnover"|PF03702|IPR005338| GO:PFM GO:0016773|"GO:phosphotransferase activity, alcohol group as acceptor"|PF03702|IPR005338| RP:SCP:NREP 2 RP:SCP:REP 81->134|1s70B|6e-04|31.9|47/291|d.211.1.1| RP:SCP:REP 169->322|1bo5O2|2e-04|12.0|150/246|c.55.1.4| HM:SCP:REP 5->352|1huxA_|2.3e-13|19.9|251/0|c.55.1.5|1/1|Actin-like ATPase domain| OP:NHOMO 484 OP:NHOMOORG 468 OP:PATTERN -----------------1-------------------------------------------------- 111----------------------1-----------1--------1-----------------11-11------------------------------1-111121111------------------------1----------11111111-11111111111111111-111---1-11--1-----1---11111111-111111------111----------------------------------------------------------------------------------------------------------1--------------1------1---------------------1----1--1111-----111111111111111111111111-11111111111-11111111111111111121111111111111111-1111111-----------------------------1--1-1111111111111111111111111111111111111111111111111111-1111111111111111-------------------------------------------------------1---111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-1111111111-1---1111111111-11--111111--1--1111111111111111111111111111111111--1-11--111111111111111111111111111111-1-----------------1--------------------------11---1------ ----111---------1--134-2111---------------------22--1311-2-222----------1-1-----------------1--------------1-1------------------------------------------------1----11-----------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 365 STR:RPRED 97.3 SQ:SECSTR #######EE#EEcTT#ccEEEEEEEccccc#cEEEEEEEEcccHHHHHHHHGGGcTTcGGcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccGEEEEEEEEEEEEETTcccEEEEEccHHHHHHHHcccEEEccHHHHHHTTccccccHHHHHHHHHcHccTTccEEEEEEccEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHcccccGGGHHHHHccccHHHHHHHHTTcGGGGcccccccccccccHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHcccEETcccEEEEEcGGGGcHHHHHHHHHcTTEEEEEEEGGGGTccTTTHHHHHHHHHHcHHHTTcccccHHHHcccccccccEEcccT DISOP:02AL 1-2| PSIPRED cccccEEEEEEEcccHHHHEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEccccccEEEEccHHHHHHHHcccEEHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEEEEcccEEEEEEEcccccccEEEEEcccHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHcccccEEEEHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcccc //