[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21567.1
DDBJ      :             YbaK/prolyl-tRNA synthetase associated region
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  113/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->159 2z0kA PDBj 2e-16 33.8 %
:RPS:PDB   44->157 2dxaA PDBj 4e-20 21.9 %
:RPS:SCOP  45->159 1dbuA  d.116.1.1 * 6e-20 21.7 %
:HMM:SCOP  10->159 1wdvA_ d.116.1.1 * 9.9e-37 33.6 %
:RPS:PFM   45->133 PF04073 * YbaK 4e-09 31.5 %
:HMM:PFM   31->149 PF04073 * YbaK 4.1e-33 28.6 119/123  
:BLT:SWISS 9->154 YWHH_BACSU 4e-11 29.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21567.1 GT:GENE AAZ21567.1 GT:PRODUCT YbaK/prolyl-tRNA synthetase associated region GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 730513..730992 GB:FROM 730513 GB:TO 730992 GB:DIRECTION + GB:PRODUCT YbaK/prolyl-tRNA synthetase associated region GB:PROTEIN_ID AAZ21567.1 GB:DB_XREF GI:71062564 LENGTH 159 SQ:AASEQ MSLLDKEPVKRAEKFLKNFDQSLEVIVLENSARTAQDAATALACDVGAIVKSLLFKAENTFILCLVAGDKRCSLNKLKKVKDKKDISMASPEEVKTQTGYTIGGVSPVGHLERIEIIIDNSLERFNELFAAAGHPNCVFKTNYNDIQKITNGKVEDIIE GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 9->154|YWHH_BACSU|4e-11|29.0|145/157| SEG 32->43|artaqdaatala| SEG 76->85|klkkvkdkkd| BL:PDB:NREP 1 BL:PDB:REP 23->159|2z0kA|2e-16|33.8|136/156| RP:PDB:NREP 1 RP:PDB:REP 44->157|2dxaA|4e-20|21.9|114/154| RP:PFM:NREP 1 RP:PFM:REP 45->133|PF04073|4e-09|31.5|89/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 31->149|PF04073|4.1e-33|28.6|119/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 45->159|1dbuA|6e-20|21.7|115/152|d.116.1.1| HM:SCP:REP 10->159|1wdvA_|9.9e-37|33.6|149/0|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 114 OP:NHOMOORG 114 OP:PATTERN ------------------------------1------------------------------------- ----1---------1----------1----------111111--11------111--1--111-1--1111-----------1-------------------------------------------------------------------------------------------------------11--1-----------------------1------1---------1--------------------------------------------------------------------------------------------1---1111-11----111--------------11-111-11-111-----------------------------------------------------1-----------1------1------1--------1------1-----------------------------1------11-1----1--------111111111-11111--11111111-11111--1----------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------1-1111111111111---------------------------------1----------------------11111---------1-------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 92.5 SQ:SECSTR ##########HHHHHHHH##HTcccEEEEcccccccHHHHHHTccTTTEEEEEEEEETTEEEEEEEEEETTcEEcHHHHHHHHTcccEEEcHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEEEETTEEEEEcHHHHHHHHTcEEEcccc DISOP:02AL 1-8| PSIPRED ccccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHcccHHHEEEEEEEEEcccEEEEEEcccccccHHHHHHHHccccEEEccHHHHHHHHcccccccccccccccccEEEEHHHHccccEEEEccccccEEEEcHHHHHHHcccEEEEEcc //