[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21573.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  101/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.293.1
:81 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->76 2o35B PDBj 8e-20 60.0 %
:RPS:SCOP  1->76 2o35A1  a.293.1.1 * 5e-29 55.3 %
:RPS:PFM   27->81 PF06844 * DUF1244 2e-17 69.1 %
:HMM:PFM   27->81 PF06844 * DUF1244 7.6e-35 74.5 55/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21573.1 GT:GENE AAZ21573.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(734825..735070) GB:FROM 734825 GB:TO 735070 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to COG3492: Uncharacterized protein conserved in bacteria GB:PROTEIN_ID AAZ21573.1 GB:DB_XREF GI:71062570 LENGTH 81 SQ:AASEQ MREDKKQELQSATFERLLKHLDKRKDVQNIDIMNLAGFCRNCLSKWYREEAEKKGIEISDLDAREHVYGMPYSEWKEKYQK GT:EXON 1|1-81:0| BL:PDB:NREP 1 BL:PDB:REP 4->76|2o35B|8e-20|60.0|70/92| RP:PFM:NREP 1 RP:PFM:REP 27->81|PF06844|2e-17|69.1|55/68|DUF1244| HM:PFM:NREP 1 HM:PFM:REP 27->81|PF06844|7.6e-35|74.5|55/68|DUF1244| RP:SCP:NREP 1 RP:SCP:REP 1->76|2o35A1|5e-29|55.3|76/79|a.293.1.1| OP:NHOMO 102 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------1111111-111------------11111111111-1111111111111---111-----111--------1---1-1------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------1111-1-1-----------------------1-1------------------------------------------------------------------------------------------------------11111-----------------------1-1111111111111111111--------------1111111111--11111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 95.1 SQ:SECSTR ###HHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHcccHHHHHHHHHHHHHHTTccccHHHHHHHHHc#cHHHHHHHHcc DISOP:02AL 1-4, 80-81| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHcc //