[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21575.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  126/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->94 2d2aB PDBj 4e-13 16.1 %
:RPS:SCOP  1->94 1nwbA  b.124.1.1 * 1e-12 21.6 %
:RPS:PFM   11->106 PF05610 * DUF779 2e-34 65.3 %
:HMM:PFM   11->106 PF05610 * DUF779 4e-46 65.3 95/95  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21575.1 GT:GENE AAZ21575.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 736964..737311 GB:FROM 736964 GB:TO 737311 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21575.1 GB:DB_XREF GI:71062572 LENGTH 115 SQ:AASEQ MKVSATPSALELIEDLKKDHGKELLFHQSGGCCDGSAPMCYPVKEFLVSDDDVLVGKIGGIPFYISETQHEAWKNTDLIIDCIQGMGGMFSLDNGTGRRFLTRSEICVPEKKSIN GT:EXON 1|1-115:0| RP:PDB:NREP 1 RP:PDB:REP 1->94|2d2aB|4e-13|16.1|87/102| RP:PFM:NREP 1 RP:PFM:REP 11->106|PF05610|2e-34|65.3|95/95|DUF779| HM:PFM:NREP 1 HM:PFM:REP 11->106|PF05610|4e-46|65.3|95/95|DUF779| RP:SCP:NREP 1 RP:SCP:REP 1->94|1nwbA|1e-12|21.6|88/101|b.124.1.1| OP:NHOMO 130 OP:NHOMOORG 127 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--1111111111111121----1-11----31111---11--1-1111-------------------------------1---1-1------------------------------------1-----------------------------------------------1-----------------1-------1111111------11--------------------------------------------------------------------------------------------------------------------------------------------1-----------11-----------1111-111111-11111111-1--1--1111111111------1------1--------1---1--------------------------------1--1-------------1------11--------1111------1111111---1----111-------------11----------------------------1---1------------------------1----------------------------------11-----------------------------------------------------------------------------------------------------------------------------------111---------------------------------------------11111------------------------------------------------------------------ -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 75.7 SQ:SECSTR cccEEcHHHHHHHHHHHHHcT#TccEEEEEEEcccEEEEEE###EccccTTEEEE#EETTEEEEEEGGGHHHHTTc##EEEEEEETEEEEEEEc##################### DISOP:02AL 110-112, 114-115| PSIPRED cEEEEcHHHHHHHHHHHHHHcccEEEEccccccccccccccccccEEEcccEEEEEEEccccEEEcccHHHHEEccEEEEEEEcccccEEEEEcccccEEEEEcEEEccHHHHcc //