[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21603.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.166.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->112 2o0qA PDBj 5e-21 42.1 %
:RPS:SCOP  5->113 2o0pA1  d.166.1.7 * 3e-33 40.4 %
:HMM:SCOP  4->115 2o0qA1 d.166.1.7 * 5.8e-37 45.5 %
:RPS:PFM   9->95 PF06108 * DUF952 4e-16 44.8 %
:HMM:PFM   9->96 PF06108 * DUF952 6.7e-32 46.6 88/93  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21603.1 GT:GENE AAZ21603.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 762333..762677 GB:FROM 762333 GB:TO 762677 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21603.1 GB:DB_XREF GI:71062600 LENGTH 114 SQ:AASEQ MNFKFVYKICTKSEWHEIKSKGQLTGSKKDLEDGYIHFSGDDQVAGTLKKFYQNQKDLILLKVDTLKLDHLVWEQASDGNMFPHLYSPLDISNVVNEFDITLDDEGNHVLPDIF GT:EXON 1|1-114:0| BL:PDB:NREP 1 BL:PDB:REP 6->112|2o0qA|5e-21|42.1|107/114| RP:PFM:NREP 1 RP:PFM:REP 9->95|PF06108|4e-16|44.8|87/93|DUF952| HM:PFM:NREP 1 HM:PFM:REP 9->96|PF06108|6.7e-32|46.6|88/93|DUF952| RP:SCP:NREP 1 RP:SCP:REP 5->113|2o0pA1|3e-33|40.4|109/113|d.166.1.7| HM:SCP:REP 4->115|2o0qA1|5.8e-37|45.5|112/0|d.166.1.7|1/1|ADP-ribosylation| OP:NHOMO 83 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111-------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----111111111111111111111111-11111111111-11111111111111111--11111111--------------11-----------------------------1-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 93.9 SQ:SECSTR #####EEEEEEHHHHHHHHHHTEEcccHHHHHHTcEEcEEHHHHHHHHHHHcTTcccEEEEEEEcGGGTTEEEEEcGGGcEEEEEcccEEGGGEEEEEEccccTTcccccHH## DISOP:02AL 18-26| PSIPRED ccccEEEEEEccccHHHHHHcccccccccccccccEEEccHHHHHHHHHHHccccccEEEEEEcHHHcccEEEEEccccccccEEEccccHHHHHHHHcccccccccEEccccc //