[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21609.1
DDBJ      :             probable ring-cleaving dioxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  94/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->131 3ghjA PDBj 6e-05 28.7 %
:RPS:PDB   9->128 3ct8A PDBj 4e-13 21.4 %
:RPS:SCOP  9->128 2pjsA1  d.32.1.2 * 5e-13 17.0 %
:HMM:SCOP  3->136 1npbA_ d.32.1.2 * 9.6e-19 25.6 %
:RPS:PFM   9->127 PF00903 * Glyoxalase 3e-07 33.9 %
:HMM:PFM   9->128 PF00903 * Glyoxalase 4.1e-09 25.2 115/128  
:BLT:SWISS 9->134 FOSB_GEOTN 7e-06 28.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21609.1 GT:GENE AAZ21609.1 GT:PRODUCT probable ring-cleaving dioxygenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 765612..766022 GB:FROM 765612 GB:TO 766022 GB:DIRECTION + GB:PRODUCT probable ring-cleaving dioxygenase GB:PROTEIN_ID AAZ21609.1 GB:DB_XREF GI:71062606 LENGTH 136 SQ:AASEQ MYKNTNCFHLAIPCGDLEKAKHFYSEILGCRLDNSAQEWADVDFWGNELTLHASEHKLESERHDVDMGNVSVPHFGVHLSRENFDALKSRLREKNTKYYDEPYLRFKGTKYEQETFFVKDPNENILEIKTLTANPG GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 9->134|FOSB_GEOTN|7e-06|28.4|116/140| BL:PDB:NREP 1 BL:PDB:REP 8->131|3ghjA|6e-05|28.7|108/114| RP:PDB:NREP 1 RP:PDB:REP 9->128|3ct8A|4e-13|21.4|117/132| RP:PFM:NREP 1 RP:PFM:REP 9->127|PF00903|3e-07|33.9|109/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 9->128|PF00903|4.1e-09|25.2|115/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 9->128|2pjsA1|5e-13|17.0|106/111|d.32.1.2| HM:SCP:REP 3->136|1npbA_|9.6e-19|25.6|117/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 118 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- -------------------------1-----------------------------------------------------------------------------11-----------------------------------------1111--11111------111---17--------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1-11-211----------1--1--------1----------11----------------------------------11--1-111111111111----11111111111111111--11---1--1-2-21------------------------------------------------------------------------------------1---1111-------------------------1---------------------------------------------------------------------------1----------------1----------1111---------------------------1111--1111-1-1111------------------------------------------------------------------------------------------------- ------1----------------------------------------------------------------------------------------------------1--------------------------------------------------------------------111----111-----1111-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 96.3 SQ:SECSTR ccGGGcccEEEEEEccHHHHHHHHHHHHHHTTEEETTEEEEEETTEEEEEEEccGGGccccccTTcccccEEEEccEcccHHHHHHHHHHHHHHTcccccTTTTTcTTcTTcccEEEEEcTTccEEEEEEc##### DISOP:02AL 56-68, 132-136| PSIPRED ccccEEEEEEEEEEccHHHHHHHHHHcccccccccccEEEEEEccccEEEEEEccccccccccccccccccccEEEEEEccccHHHHHHHHHHccccEEEccEEEEccccccEEEEEEEcccccEEEEEEcccccc //