[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21610.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   76->108 PF08220 * HTH_DeoR 6.4e-05 24.2 33/57  
:HMM:PFM   18->65 PF00456 * Transketolase_N 0.0006 29.8 47/333  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21610.1 GT:GENE AAZ21610.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 766031..766501 GB:FROM 766031 GB:TO 766501 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21610.1 GB:DB_XREF GI:71062607 LENGTH 156 SQ:AASEQ MTNKVAAYSEILYHLINFRTDQFQQLKKMLGIDYDSFMILSVMGAHYLKHSDKLGSDWEAVWKNLRTSKIEEFYIARKLTIYAVANILNLPKETVRRKIEILKKKKLISHSTKMGLLPTNKTEEIMKPFAEIELKTLSKFLKNLKKNNTLEKVLNF GT:EXON 1|1-156:0| SEG 98->108|kieilkkkkli| SEG 134->155|lktlskflknlkknntlekvln| HM:PFM:NREP 2 HM:PFM:REP 76->108|PF08220|6.4e-05|24.2|33/57|HTH_DeoR| HM:PFM:REP 18->65|PF00456|0.0006|29.8|47/333|Transketolase_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcc //