[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21612.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   119->169 PF03951 * Gln-synt_N 0.00011 28.6 49/84  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21612.1 GT:GENE AAZ21612.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 767594..768199 GB:FROM 767594 GB:TO 768199 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21612.1 GB:DB_XREF GI:71062609 LENGTH 201 SQ:AASEQ MTKVEICESGSTIANCLNPIDITTGNGATADIASVEAGVTAATVADFGKATLGKTYTYIQTTMSRAMTITGTAGNCKTKAGINGSLGGSAGGAAVGHTGTAGSAILYVPHFTQDTANYSMMEGSNADGSSLATLATVRTTDTHFRSRQILTSPYTPVAGSSPTVFVAFDTSVAVNEVDDASCTDAGLQAAPPTVTLTVQGQ GT:EXON 1|1-201:0| SEG 80->104|agingslggsaggaavghtgtagsa| HM:PFM:NREP 1 HM:PFM:REP 119->169|PF03951|0.00011|28.6|49/84|Gln-synt_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 6-7, 124-125| PSIPRED ccEEEEEccccHHHHHcccEEEEccccccccHHHHccccEEEHHHHHccHHccccHHHHHHHHHcEEEEEEcccccEEcccccccccccccccccccccccccEEEEEEccccccccEEEEcccccccccEEEEEEEEEcccHHcccEEEccccccccccccEEEEEEcccEEEEcccccccccccccccccEEEEEEEcc //