[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21633.1
DDBJ      :             membrane-associated zinc metalloprotease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  770/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
b.36.1
:377 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   138->207 2ytwA PDBj 1e-08 39.7 %
:RPS:PDB   127->198 3cs0A PDBj 1e-09 19.7 %
:RPS:SCOP  136->203 2hgaA1  b.36.1.6 * 2e-08 25.4 %
:HMM:SCOP  111->208 1sotA1 b.36.1.4 * 1.2e-16 26.5 %
:RPS:PFM   8->347 PF02163 * Peptidase_M50 3e-37 32.9 %
:HMM:PFM   8->362 PF02163 * Peptidase_M50 6.9e-60 39.1 192/193  
:BLT:SWISS 1->366 Y1380_AGRT5 4e-74 41.6 %
:PROS 16->25|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21633.1 GT:GENE AAZ21633.1 GT:PRODUCT membrane-associated zinc metalloprotease GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 790317..791450 GB:FROM 790317 GB:TO 791450 GB:DIRECTION + GB:PRODUCT membrane-associated zinc metalloprotease GB:NOTE putative GB:PROTEIN_ID AAZ21633.1 GB:DB_XREF GI:71062630 LENGTH 377 SQ:AASEQ MLSYILPFIALIVVVVFIHEYGHYYFAKRYGVGVTDFSIGFGKEMFGWNDKSGTRWKVCVIPLGGYVKFFGDRNVYSQADNDKIIKEYSKEDQDKLFVLKPLYQRALIVFGGPLANFLLAILIFFSVYTFFGKDFTPAVINEVQKDSPAMVAGLKDNDIVVSIDGNEVTSIMDVSKYIMMSTDEFINFTVNRFDQDLTFRVKPNIVEGEDNLGNKISKRMVGIKLGAYNNEVNHVKLGPTKALFYAVNEVYYVSTSSLKYIGSMLTGNGDTSQLGGPIRIAKISGQVAEFGILPFISLMAYISISLGLINLFPIPMLDGGHLMFYGIEKVLGRPLSQKTQEGFFRIGMFLLLSLMFFTTFNDLKDVGLFKFFNNYIS GT:EXON 1|1-377:0| BL:SWS:NREP 1 BL:SWS:REP 1->366|Y1380_AGRT5|4e-74|41.6|365/377| PROS 16->25|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 5 TM:REGION 1->23| TM:REGION 106->128| TM:REGION 245->267| TM:REGION 291->313| TM:REGION 341->363| SEG 114->125|lanfllailiff| SEG 348->360|mflllslmffttf| BL:PDB:NREP 1 BL:PDB:REP 138->207|2ytwA|1e-08|39.7|68/118| RP:PDB:NREP 1 RP:PDB:REP 127->198|3cs0A|1e-09|19.7|71/379| RP:PFM:NREP 1 RP:PFM:REP 8->347|PF02163|3e-37|32.9|313/331|Peptidase_M50| HM:PFM:NREP 1 HM:PFM:REP 8->362|PF02163|6.9e-60|39.1|192/193|Peptidase_M50| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| RP:SCP:NREP 1 RP:SCP:REP 136->203|2hgaA1|2e-08|25.4|67/103|b.36.1.6| HM:SCP:REP 111->208|1sotA1|1.2e-16|26.5|98/99|b.36.1.4|1/1|PDZ domain-like| OP:NHOMO 801 OP:NHOMOORG 780 OP:PATTERN -------------------------------------------------------------------- 111-1-11------1--11-11----11111-1----------1--11----111---11--111-11-1-----------111111111--11111--11-11--1111--------------1111221111111----11--1111-111111111---1-11211111-11111-11111--1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111-1111111-1111111111111111111111111111-111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122222121111111111111-1-1-----11111111111111111111111111111111111111-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111121--22221111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111111-11-111111-------------------------111111111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111-13--2-21-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 21.8 SQ:SECSTR ##############################################################################################################################cccEccTTTccEEEcccccccTTGGGTccTTcEEccccccccccHHHHHHHHHTccccEcEEEEEETTEEEEHHHHccEEcc######################################################################################################################################################################### DISOP:02AL 73-94, 202-220| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHEEEccccEEEEEEEEEEcEEEEEccccccccccccccccccccccHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEccEEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEEcccccccccccccccEEEEEEccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccEEEEEcHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //