[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21640.1
DDBJ      :             Putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   117->146 PF02096 * 60KD_IMP 0.00012 33.3 30/196  
:HMM:PFM   7->70 PF08019 * DUF1705 0.00016 26.6 64/156  
:BLT:SWISS 18->88 PCBA_PROMA 4e-04 26.8 %
:TM
:REPEAT 2|48->89|91->126

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21640.1 GT:GENE AAZ21640.1 GT:PRODUCT Putative integral membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(795867..796340) GB:FROM 795867 GB:TO 796340 GB:DIRECTION - GB:PRODUCT Putative integral membrane protein GB:PROTEIN_ID AAZ21640.1 GB:DB_XREF GI:71062637 LENGTH 157 SQ:AASEQ MIDQIYTYFTIEMIFLWLNLGVLPFWLILVFFPQSQICRVFITSIFPFIILSFAYGYLTYVLFNGGYDFVRNFELYLGLDSISYLFNDKSFLILFWTHFLSINLFCGGWIVKDSQKFGINKIIMSFPLLITYFIGPIGLTLYWIIRIFYAKRINLYD GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 18->88|PCBA_PROMA|4e-04|26.8|71/100| TM:NTM 4 TM:REGION 10->32| TM:REGION 38->60| TM:REGION 85->107| TM:REGION 124->146| NREPEAT 1 REPEAT 2|48->89|91->126| HM:PFM:NREP 2 HM:PFM:REP 117->146|PF02096|0.00012|33.3|30/196|60KD_IMP| HM:PFM:REP 7->70|PF08019|0.00016|26.6|64/156|DUF1705| OP:NHOMO 25 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------1-111------11------11--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------11--------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------26------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-18,157-158| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //