[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21642.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->47 PF11337 * DUF3139 0.0003 26.2 42/85  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21642.1 GT:GENE AAZ21642.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(796924..797070) GB:FROM 796924 GB:TO 797070 GB:DIRECTION - GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21642.1 GB:DB_XREF GI:71062639 LENGTH 48 SQ:AASEQ MDEQLRIILIIIVSVSIFGLLVFVFVKNVIRNRIQSLVEEEEKEKKLK GT:EXON 1|1-48:0| TM:NTM 1 TM:REGION 7->29| SEG 7->17|iiliiivsvsi| SEG 39->46|eeeekekk| HM:PFM:NREP 1 HM:PFM:REP 6->47|PF11337|0.0003|26.2|42/85|DUF3139| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 37-48| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //