[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21644.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->64 PF12073 * DUF3553 2e-11 55.3 %
:HMM:PFM   17->67 PF12073 * DUF3553 8e-28 52.9 51/52  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21644.1 GT:GENE AAZ21644.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(797837..798043) GB:FROM 797837 GB:TO 798043 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21644.1 GB:DB_XREF GI:71062641 LENGTH 68 SQ:AASEQ MIFISILTISKLMILDFEPGDKVINPNNKDWGTGQVQSIINGKVTVNFENVGKKVINSKIIQLEKLHK GT:EXON 1|1-68:0| TM:NTM 1 TM:REGION 1->23| RP:PFM:NREP 1 RP:PFM:REP 18->64|PF12073|2e-11|55.3|47/51|DUF3553| HM:PFM:NREP 1 HM:PFM:REP 17->67|PF12073|8e-28|52.9|51/52|DUF3553| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------1---1-----------------1--------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 67-68| PSIPRED cEEEEEHHHHHHHHHccccccEEEccccccccccEEEEccccEEEEEEccccEEEEEccEEEEEEccc //