[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21647.1
DDBJ      :             probable MFS transporter (Major Facilitator Superfamily)
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  185/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:406 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->170 1pw4A  f.38.1.1 * 2e-07 10.8 %
:HMM:SCOP  1->395 1pw4A_ f.38.1.1 * 1.3e-59 23.7 %
:RPS:PFM   43->275 PF07690 * MFS_1 1e-06 25.2 %
:HMM:PFM   20->322 PF07690 * MFS_1 1.6e-33 20.5 298/353  
:HMM:PFM   324->393 PF07690 * MFS_1 1.8e-06 26.1 69/353  
:BLT:SWISS 12->97,216->401 YBFB_BACSU 8e-18 26.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21647.1 GT:GENE AAZ21647.1 GT:PRODUCT probable MFS transporter (Major Facilitator Superfamily) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 800522..801742 GB:FROM 800522 GB:TO 801742 GB:DIRECTION + GB:PRODUCT probable MFS transporter (Major Facilitator Superfamily) GB:PROTEIN_ID AAZ21647.1 GB:DB_XREF GI:71062644 LENGTH 406 SQ:AASEQ MSSEKFIQNKTALITLIAACIVVLISLGVRQTFGLFFMDFKNDLDISITQSGLAIGIQMLMWGLTGPIFGAIADKYGGHKAICLAFVFYILGIYFLYAGPNTGIFFQIDLGLLVGIGLGGTAISIPMSIVGKHFPLSNRTIAMSIVTAVGSLGYFISPLYTSYSLIKNGWVDTLFVFTIFLFIGLIIAFFVRSPSAAQSIEKPNNQSAIEAFKEAFKNKSYILLVSGFFVCGFHITLVGTHVPKYVIDRGLESWTAAAILSLIGLFNIFGSLLSGYLSTKISKKIILSSIYALRGISIILFIFLPASNINAFIFGASFGFLWLSTVPATSGIVAHIFGTKYLGILYGIVFLSHQVGSFFGAFLGGLFHDLYGSYDYAWYLAIVLSIFAAIIHLPIKEEAVLRLKIE GT:EXON 1|1-406:0| BL:SWS:NREP 1 BL:SWS:REP 12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416| TM:NTM 12 TM:REGION 9->31| TM:REGION 51->73| TM:REGION 77->99| TM:REGION 106->128| TM:REGION 138->160| TM:REGION 172->194| TM:REGION 219->241| TM:REGION 256->278| TM:REGION 285->307| TM:REGION 314->336| TM:REGION 345->367| TM:REGION 374->396| SEG 110->120|lgllvgiglgg| SEG 174->190|lfvftiflfigliiaff| SEG 277->290|lstkiskkiilssi| SEG 356->367|gsffgaflgglf| RP:PFM:NREP 1 RP:PFM:REP 43->275|PF07690|1e-06|25.2|230/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 20->322|PF07690|1.6e-33|20.5|298/353|MFS_1| HM:PFM:REP 324->393|PF07690|1.8e-06|26.1|69/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 4->170|1pw4A|2e-07|10.8|166/434|f.38.1.1| HM:SCP:REP 1->395|1pw4A_|1.3e-59|23.7|389/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 273 OP:NHOMOORG 193 OP:PATTERN -----------------------1-------------------------------------------- -------------------------1----------1111--1---------111---------2-1111---------------------------------------------------------------------------1-----------------------1-------------11--------1---------------1-11-1----------------11--------------------------------------------------------------------------------------------------------------------------------------------------------1-4221-22122211111111111-1111111111--12211111111122---1111111112-------------411-----------------------------1--2--131352222222222222222222122224434-122112122222321112-----1-1-11-1---122------------------------11-1--1--------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------2---------------111111----1-11111111111111111-----------111-----111-----1-11------------------------------------------------------------------ -------------------------------------------------------1-----------------------------------------------213----1-----------------------------------------------------1---------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 404-406| PSIPRED ccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccc //