[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21655.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21655.1 GT:GENE AAZ21655.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 807867..808217 GB:FROM 807867 GB:TO 808217 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21655.1 GB:DB_XREF GI:71062652 LENGTH 116 SQ:AASEQ MSLLEKSDDEIIAIANPIWDNLVKTSNMKDYGGFTKDFGTQMLFGANEVELGKQWANNKLLTSLKEDYQAFGCLRRGQNITVLFKQRSKEIEGEFLGRLVLGIEGDDVKVFGATIY GT:EXON 1|1-116:0| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------11--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccEEEEEEEEEcccccHHHEEEEEEEEEccEEEEEEEEcc //