[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21656.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->33 PF08129 * Antimicrobial17 0.00071 36.7 30/57  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21656.1 GT:GENE AAZ21656.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 808285..808419 GB:FROM 808285 GB:TO 808419 GB:DIRECTION + GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21656.1 GB:DB_XREF GI:71062653 LENGTH 44 SQ:AASEQ MSISNIKILKKILDFKATIIKTGIFVSLAAYWGVILVGTFITFN GT:EXON 1|1-44:0| TM:NTM 1 TM:REGION 18->40| SEG 6->13|ikilkkil| HM:PFM:NREP 1 HM:PFM:REP 4->33|PF08129|0.00071|36.7|30/57|Antimicrobial17| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //