[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21671.1
DDBJ      :             peptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  661/915 : Eukaryota  6/199 : Viruses  4/175   --->[See Alignment]
b.71.1b.84.3
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   161->263 2hsiB PDBj 6e-20 41.2 %
:RPS:PDB   141->246 2b13A PDBj 7e-21 31.1 %
:RPS:SCOP  165->265 2fhbA4  b.71.1.1 * 3e-22 14.0 %
:HMM:SCOP  82->263 1qwyA_ b.84.3.2 * 4.6e-40 31.9 %
:RPS:PFM   165->251 PF01551 * Peptidase_M23 8e-17 50.0 %
:HMM:PFM   164->259 PF01551 * Peptidase_M23 2.3e-29 48.4 95/96  
:BLT:SWISS 164->246 YEBA_SHIFL 4e-16 46.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21671.1 GT:GENE AAZ21671.1 GT:PRODUCT peptidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(824837..825637) GB:FROM 824837 GB:TO 825637 GB:DIRECTION - GB:PRODUCT peptidase GB:NOTE M23/M37 family GB:PROTEIN_ID AAZ21671.1 GB:DB_XREF GI:71062668 LENGTH 266 SQ:AASEQ MDSKVIYRLLSLVALFFSTQSFAVEFQGKFIQGHYIIGKTKPGSSIFVDKKKVKVTKDGYFAFGIEKDRKFDITITENNKKIVKKIKKRKYNIQKIEGLPKKKVTPPEEFYARIKKENKLIADAREIESDLQFFKEKFIIPVDDAIITGVYGSQRILNGIPKWPHYGLDFAQKKGTPVKAMNNGVVTLAEKDLFYTGATLIFDHGHGVSTLYMHMDEIFVNVGDHVKKGDIIATVGSSGRSTGPHLDVRLNWFGTRLDPATILNIQ GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 164->246|YEBA_SHIFL|4e-16|46.3|82/440| SEG 48->58|vdkkkvkvtkd| SEG 73->96|ititennkkivkkikkrkyniqki| BL:PDB:NREP 1 BL:PDB:REP 161->263|2hsiB|6e-20|41.2|102/228| RP:PDB:NREP 1 RP:PDB:REP 141->246|2b13A|7e-21|31.1|106/131| RP:PFM:NREP 1 RP:PFM:REP 165->251|PF01551|8e-17|50.0|86/96|Peptidase_M23| HM:PFM:NREP 1 HM:PFM:REP 164->259|PF01551|2.3e-29|48.4|95/96|Peptidase_M23| RP:SCP:NREP 1 RP:SCP:REP 165->265|2fhbA4|3e-22|14.0|100/118|b.71.1.1| HM:SCP:REP 82->263|1qwyA_|4.6e-40|31.9|182/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 1440 OP:NHOMOORG 671 OP:PATTERN -------------------------------------------------------------------- 112-11-211-1--11111-141111111111212256361--1-211-111232-12--122-222443-------------2-511232524112--1212331112----------------121314331321-------12C21311-323312232212445563-3-----3----21222221---11111111111111111--11111---1-111-----52-11111111111111-----2-------------------------111-----------------------------------------343--22222121113-11-343214-1611637544344423555521-12-43311----123333333333233333333334-33343433134-422222323233314241111111111-------------42311----------11111111111111-11254342433321111111------11------1111-121111121222222223321112211111111123-2222342223545344352521224344434522-1223333332314111111133122--331324333224444454564544454554--1322311----11111211111111211-121111111211111111121211211111111111111111111111111112111111111111112222222222134231111111111-21112222221---3233332222432323222---------223454334343433333434422233332-336666774443444454--------------------------1112111111--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------5--1--1--1---- -1------------------------------------------------------------------------------------------------------11--------------------1------------------------------------------------ STR:NPRED 169 STR:RPRED 63.5 SQ:SECSTR #################################################################################################cHHHHHHHcccccEEccTTcTTEEEEEEEEHHHHcEEEEEEEcccccHHHHTccEEEccEEcTTccEEccEEEEccTTcEEEccccEEEEEEEEccccccEEEEEEETTccEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEEccccEccHHHHHHH DISOP:02AL 1-2, 26-33, 94-111, 120-134| PSIPRED cccHHHHHHHHHHEEEEEEcEEEEEEcccccccEEEEEEEccccEEEEccEEEEccccEEEEEEccccccEEEEEEEccEEEEEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEccccccccccccccccEEEEEccccccEEEEccccEEEEEEcccccccEEEEEEEcccEEEEEEEccccccccccEEEcccEEEEEcccccccccEEEEEEEEccEEEccHHccccc //